Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32583 74 / 1e-17 unknown protein AT4G24972 67 / 5e-15 TPD1 tapetum determinant 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G105600 [exp] 147 / 8e-47 AT4G24972 106 / 2e-29 tapetum determinant 1 (.1) Potri.006G017600 [exp] 81 / 2e-20 AT1G32583 187 / 5e-61 unknown protein Potri.012G102900 [exp] 74 / 8e-18 AT1G32583 160 / 2e-50 unknown protein Potri.015G101000 [exp] 72 / 4e-17 AT1G32583 157 / 5e-49 unknown protein Potri.010G246900 [exp] 44 / 1e-06 AT1G32583 104 / 3e-29 unknown protein Potri.010G246300 [exp] 41 / 2e-05 AT1G32583 85 / 1e-21 unknown protein Potri.002G233000 [exp] 40 / 3e-05 AT1G05835 111 / 2e-32 PHD finger protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016744 [exp] 68 / 2e-15 AT4G24972 172 / 5e-55 tapetum determinant 1 (.1) Lus10022437 [exp] 69 / 1e-14 AT5G51140 505 / 1e-177 Pseudouridine synthase family protein (.1.2) Lus10001911 [exp] 63 / 5e-14 AT1G32583 157 / 5e-50 unknown protein Lus10026289 [exp] 47 / 1e-07 AT4G32090 72 / 5e-17 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10042384 [exp] 40 / 3e-05 AT4G32110 81 / 1e-20 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G145501.1 pacid=42797272 polypeptide=Potri.010G145501.1.p locus=Potri.010G145501 ID=Potri.010G145501.1.v4.1 annot-version=v4.1 ATGATATTGGGAGAAAAGCTCAGGGGCAGCTCAGAAGTTGGTGACGATACAAACAGATATAGATATATATATATAAGCATCTCTCAAAGTAGAGACACCA CTTTTGGGATCCCACAGTACACGGTGCAGATTGTCAACACCTGTGTTTTTGGTTGTGCTCCTTCAAATATTCACTTCCATTGTGGCTGGCTCTCTTATGA TGATTGCTTGGTCAATGGAGGGAAAGCTTTGAAGACTAGTCAGGTTGTCAGATTCACATACTCAAATTCCTTCATGTACGCACTCCAATTTAAGTCTGCC AAGTTGTGTTGA
AA sequence Show only first row Show all	>Potri.010G145501.1 pacid=42797272 polypeptide=Potri.010G145501.1.p locus=Potri.010G145501 ID=Potri.010G145501.1.v4.1 annot-version=v4.1 MILGEKLRGSSEVGDDTNRYRYIYISISQSRDTTFGIPQYTVQIVNTCVFGCAPSNIHFHCGWLSYDDCLVNGGKALKTSQVVRFTYSNSFMYALQFKSA KLC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G32583			unknown protein		Potri.010G145501 [exp]	0	1
AT4G30880			Bifunctional inhibitor/lipid-t...		Potri.009G048900 [exp]	10.81	1.0000
AT2G05920			Subtilase family protein (.1)		Potri.001G113533 [exp]	16.49	1.0000
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G177300 [exp]	16.97	1.0000
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.013G118200 [exp]	17.54	0.9944
					Potri.006G040201 [exp]	17.88	0.9808
					Potri.014G045150 [exp]	17.97	1.0000
AT1G67320		EMB2813	EMBRYO DEFECTIVE 2813, DNA pri...		Potri.017G053801 [exp]	18.16	0.9807
					Potri.019G036825 [exp]	18.43	1.0000
AT3G48700		ATCXE13	carboxyesterase 13 (.1)		Potri.009G104200 [exp]	18.46	0.9888
					Potri.004G099900 [exp]	18.54	0.9573

Compare expression of checked genes

Potri.010G145501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.