Potri.010G146301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G23540 41 / 1e-05 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT3G50400 41 / 1e-05 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G216400 54 / 3e-10 AT2G23540 240 / 1e-76 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.008G104700 51 / 4e-09 AT2G23540 280 / 1e-91 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.008G104600 50 / 7e-09 AT2G23540 370 / 3e-127 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.007G036300 37 / 0.0002 AT2G23540 554 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005238 62 / 4e-13 AT2G23540 369 / 2e-126 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10005236 62 / 6e-13 AT2G23540 390 / 1e-134 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10030684 62 / 7e-13 AT2G23540 244 / 2e-78 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10016918 59 / 7e-12 AT2G23540 381 / 6e-131 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10016775 38 / 0.0002 AT2G23540 592 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10022471 38 / 0.0002 AT2G23540 589 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.010G146301.1 pacid=42797045 polypeptide=Potri.010G146301.1.p locus=Potri.010G146301 ID=Potri.010G146301.1.v4.1 annot-version=v4.1
ATGCTGATATTTATACTATATGGCTTCGAAAATGCGAACTATGCTTGCTGCCATCTTATAGGACCTCATGGGGGACTGCTACCATGTGGAAATATGTCAC
TAGTTTGTCCTGAAAGAACAAACAAAACATCTGATGCATGGCGGCTTAAATTACAGATCACCGATGAATATTCAACAAATTCTGAATTCTTGAATTGTTC
ACATAAATGA
AA sequence
>Potri.010G146301.1 pacid=42797045 polypeptide=Potri.010G146301.1.p locus=Potri.010G146301 ID=Potri.010G146301.1.v4.1 annot-version=v4.1
MLIFILYGFENANYACCHLIGPHGGLLPCGNMSLVCPERTNKTSDAWRLKLQITDEYSTNSEFLNCSHK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G23540 GDSL-like Lipase/Acylhydrolase... Potri.010G146301 0 1

Potri.010G146301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.