Potri.010G148300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G49525 57 / 2e-12 unknown protein
AT5G26790 40 / 5e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G102400 111 / 3e-34 AT5G49525 53 / 4e-11 unknown protein
Potri.005G011400 58 / 1e-12 AT5G49525 49 / 6e-09 unknown protein
Potri.013G007500 56 / 9e-12 AT5G49525 47 / 4e-08 unknown protein
Potri.004G131200 37 / 0.0001 AT5G46295 / unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037793 100 / 1e-27 AT3G17152 74 / 5e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10017078 97 / 2e-26 AT5G49525 57 / 3e-12 unknown protein
Lus10011181 57 / 3e-12 AT5G49525 50 / 5e-10 unknown protein
Lus10015445 55 / 1e-11 ND 49 / 2e-09
Lus10015269 40 / 3e-05 AT1G06475 59 / 1e-12 unknown protein
Lus10025392 39 / 6e-05 AT1G06475 59 / 1e-12 unknown protein
PFAM info
Representative CDS sequence
>Potri.010G148300.1 pacid=42798944 polypeptide=Potri.010G148300.1.p locus=Potri.010G148300 ID=Potri.010G148300.1.v4.1 annot-version=v4.1
ATGCGTCCTATGTGGTATCCATCCATTTTCAGGTGGCCGGAATTCGGATTCTCTATGCCATCATCGTCAATTCTTCGGTGGCCGGAATTTGATTTCTCGT
ATTTCACAACAAGGTTGACTCTAGAGAGCTTGAGGTGGTTGGATTTTGCTATTGATGATGTGTTGTGGACCTTTGTTACGGCGCTGGAGTCCGTGGCTTT
AACTGCTATGCTTTGCTACTTCTTTGTATTCTGTGGCTGCACTCTCTGA
AA sequence
>Potri.010G148300.1 pacid=42798944 polypeptide=Potri.010G148300.1.p locus=Potri.010G148300 ID=Potri.010G148300.1.v4.1 annot-version=v4.1
MRPMWYPSIFRWPEFGFSMPSSSILRWPEFDFSYFTTRLTLESLRWLDFAIDDVLWTFVTALESVALTAMLCYFFVFCGCTL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G49525 unknown protein Potri.010G148300 0 1
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Potri.012G077200 1.00 0.8746
AT2G29420 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, ... Potri.010G061800 2.00 0.8670
AT3G22260 Cysteine proteinases superfami... Potri.016G019700 4.47 0.8192
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Potri.002G039100 5.19 0.8204
AT4G26740 CLO1, ATPXG1, A... CALEOSIN1, ARABIDOPSIS THALIAN... Potri.010G066600 12.00 0.7855 Pt-GMPM13.1
AT3G16030 CES101 CALLUS EXPRESSION OF RBCS 101,... Potri.001G441400 14.83 0.8388
AT1G14370 Kin1, PBL2, APK... PBS1-like 2, kinase 1, protein... Potri.009G020700 17.14 0.8259
AT2G29050 ATRBL1 RHOMBOID-like 1 (.1.2) Potri.006G086300 19.36 0.8402
AT3G17980 AtC2 Arabidopsis thaliana C2 domain... Potri.012G047100 22.91 0.7813
AT5G04760 MYB Duplicated homeodomain-like su... Potri.010G240800 29.93 0.7965

Potri.010G148300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.