Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49540 137 / 5e-43 Rab5-interacting family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G102200 [exp] 184 / 2e-61 AT5G49540 171 / 1e-56 Rab5-interacting family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029365 [exp] 131 / 8e-41 AT5G49540 139 / 7e-44 Rab5-interacting family protein (.1) Lus10016182 [exp] 130 / 1e-39 AT5G49540 140 / 4e-43 Rab5-interacting family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07019 [poplar] [flax] Rab5ip Rab5-interacting protein (Rab5ip)
Representative CDS sequence Show only first row Show all	>Potri.010G148600.2 pacid=42798341 polypeptide=Potri.010G148600.2.p locus=Potri.010G148600 ID=Potri.010G148600.2.v4.1 annot-version=v4.1 ATGGCTGGACATAATGAGTCTGAGAAGAAATCAAGTGATGCCGTGAATGATTTGCAAACATTCAGAGCTGAAAATTTGCAAAGTAACATGAAAGTTATAT ATTACAGCCGAACATTTCTGTCTATCATTGGTGGGGTAATTGCTGGAATCTTGGGACTCACTGGCTTGACTGGATTTGTCTTTTATTTTCTTATGATGAC AATCACTTCAGTTTCACTCATAGCTAAGGCAAAGTTTTCCATTCATACATACTTTGACTCCTGGAACAGGGTTTTACTTGATGGCTTTTTGGGTGGGCTT ATGTCGTTCGTGCTGTTCTGGACATTTGCTTATGACATTGTGCATATATTCTGA
AA sequence Show only first row Show all	>Potri.010G148600.2 pacid=42798341 polypeptide=Potri.010G148600.2.p locus=Potri.010G148600 ID=Potri.010G148600.2.v4.1 annot-version=v4.1 MAGHNESEKKSSDAVNDLQTFRAENLQSNMKVIYYSRTFLSIIGGVIAGILGLTGLTGFVFYFLMMTITSVSLIAKAKFSIHTYFDSWNRVLLDGFLGGL MSFVLFWTFAYDIVHIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G49540			Rab5-interacting family protei...		Potri.010G148600 [exp]	0	1
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Potri.009G047300 [exp]	2.00	0.9239
AT1G09330		ECHIDNA, ECH	unknown protein		Potri.013G006250 [exp]	2.82	0.9212
AT5G52210		ATGB1, ATARLB1	GTP-binding protein 1 (.1.2)		Potri.012G138500 [exp]	6.32	0.9118
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Potri.001G165600 [exp]	7.74	0.9048	Pt-SEC22.1
AT2G33470		ATGLTP1, GLTP1	ARABIDOPSIS GLYCOLIPID TRANSFE...		Potri.010G069600 [exp]	9.48	0.8938
AT4G35410			Clathrin adaptor complex small...		Potri.014G079000 [exp]	10.39	0.9202	AP19.1
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Potri.018G039200 [exp]	10.95	0.8923
AT5G49540			Rab5-interacting family protei...		Potri.008G102200 [exp]	11.09	0.8737
AT3G07810			RNA-binding (RRM/RBD/RNP motif...		Potri.001G361300 [exp]	12.00	0.8850
AT5G15770		ATGNA1	glucose-6-phosphate acetyltran...		Potri.018G086400 [exp]	12.40	0.8995

Compare expression of checked genes

Potri.010G148600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.