Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G54940 171 / 1e-56 Translation initiation factor SUI1 family protein (.1.2) AT1G54290 169 / 4e-56 Translation initiation factor SUI1 family protein (.1) AT4G27130 167 / 3e-55 Translation initiation factor SUI1 family protein (.1) AT5G54760 167 / 4e-55 Translation initiation factor SUI1 family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G134700 [exp] 163 / 2e-53 AT4G27130 213 / 3e-73 Translation initiation factor SUI1 family protein (.1) Potri.001G418600 [exp] 162 / 4e-53 AT1G54290 218 / 2e-75 Translation initiation factor SUI1 family protein (.1) Potri.007G122600 [exp] 160 / 1e-52 AT4G27130 215 / 3e-74 Translation initiation factor SUI1 family protein (.1) Potri.007G122700 [exp] 160 / 2e-52 AT4G27130 217 / 5e-75 Translation initiation factor SUI1 family protein (.1) Potri.017G037100 [exp] 142 / 2e-45 AT1G54290 187 / 2e-63 Translation initiation factor SUI1 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021532 [exp] 183 / 2e-61 AT5G54940 169 / 9e-56 Translation initiation factor SUI1 family protein (.1.2) Lus10039660 [exp] 162 / 5e-53 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) Lus10027181 [exp] 162 / 5e-53 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) Lus10015124 [exp] 161 / 7e-53 AT4G27130 209 / 8e-72 Translation initiation factor SUI1 family protein (.1) Lus10031550 [exp] 162 / 1e-52 AT4G27130 207 / 2e-70 Translation initiation factor SUI1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01253 [poplar] [flax] SUI1 Translation initiation factor SUI1
Representative CDS sequence Show only first row Show all	>Potri.010G151700.1 pacid=42797150 polypeptide=Potri.010G151700.1.p locus=Potri.010G151700 ID=Potri.010G151700.1.v4.1 annot-version=v4.1 ATGGTGCTAGAATTCGAGATTCCTAGCGCTTTCGATCCATTTGCCGATGCCAAACAGTCAGGGACCAAAGAGTATGTGCACATACGCATACAGCAAAGGA ATGGAAAGAAGAGCTTGACTACAGTTCAGGGTCTACCTAAAGAGTTGAGCTACGAAAAGATCCTCAAGACTCTCAAGAAAGATTTCTGTTGTAATGGGAA TGTTGTGCAGGACAAGGAACTTGGCAAGGTCATTCAACTCCAAGGTGATCAACGCAAGAACGTCCAGAATTTCCTTGTTAATCAGAACATTGTGAAGAAG GACCAGATCAAGATTCATGGTTTTTGA
AA sequence Show only first row Show all	>Potri.010G151700.1 pacid=42797150 polypeptide=Potri.010G151700.1.p locus=Potri.010G151700 ID=Potri.010G151700.1.v4.1 annot-version=v4.1 MVLEFEIPSAFDPFADAKQSGTKEYVHIRIQQRNGKKSLTTVQGLPKELSYEKILKTLKKDFCCNGNVVQDKELGKVIQLQGDQRKNVQNFLVNQNIVKK DQIKIHGF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G54940			Translation initiation factor ...		Potri.010G151700 [exp]	0	1
AT4G25225			unknown protein		Potri.001G124100 [exp]	1.00	0.7661
AT4G27130			Translation initiation factor ...		Potri.007G122600 [exp]	8.12	0.6753
AT5G08750			RING/FYVE/PHD zinc finger supe...		Potri.005G070100 [exp]	10.95	0.6546
AT5G02500		AtHsp70-1, AT-H...	HEAT SHOCK PROTEIN 70-1, ARABI...		Potri.010G205800 [exp]	11.22	0.6559
					Potri.005G149601 [exp]	11.22	0.6600
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Potri.012G000800 [exp]	16.06	0.6980
AT3G51780		ATBAG4	BCL-2-associated athanogene 4 ...		Potri.016G121200 [exp]	16.91	0.6604
AT1G14720		ATXTH28, EXGT-A...	xyloglucan endotransglycosylas...		Potri.008G138400 [exp]	18.33	0.6629	EXGT.4
AT4G25310			2-oxoglutarate (2OG) and Fe(II...		Potri.002G086550 [exp]	19.20	0.6713
AT5G11730			Core-2/I-branching beta-1,6-N-...		Potri.006G233400 [exp]	20.14	0.6422

Compare expression of checked genes

Potri.010G151700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.