Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	B5.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26340 165 / 1e-53 B5 #6, B5#6, ATCB5-A ARABIDOPSIS CYTOCHROME B5 ISOFORM A, cytochrome B5 isoform A (.1) AT2G32720 119 / 1e-35 B5 #4, B5#4, ATCB5-B ARABIDOPSIS CYTOCHROME B5 ISOFORM B, cytochrome B5 isoform B (.1) AT5G48810 112 / 1e-32 B5#3, ATB5-B, ATCB5-D ARABIDOPSIS CYTOCHROME B5 ISOFORM D, cytochrome B5 isoform D (.1) AT5G53560 108 / 3e-31 B5#2, ATB5-A, ATCB5-E ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) AT2G46650 98 / 4e-27 B5 #1, B5#1, ATCB5-C ARABIDOPSIS CYTOCHROME B5 ISOFORM C, cytochrome B5 isoform C (.1) AT1G37130 84 / 8e-20 NIA2-1, CHL3, B29, NR2, NIA2, ATNR2 CHLORATE RESISTANT 3, ARABIDOPSIS NITRATE REDUCTASE 2, nitrate reductase 2 (.1) AT1G60660 77 / 6e-19 B5 #5, B5#5, ATCB5LP ARABIDOPSIS CYTOCHROME B5-LIKE PROTEIN, cytochrome B5-like protein (.1) AT1G77760 80 / 3e-18 GNR1, NIA1 nitrate reductase 1 (.1) AT3G61580 63 / 2e-12 AtSLD1 sphingoid LCB desaturase 1, Fatty acid/sphingolipid desaturase (.1) AT2G46210 61 / 1e-11 AtSLD2 sphingoid LCB desaturase 2, Fatty acid/sphingolipid desaturase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G242500 [exp] 117 / 1e-34 AT2G32720 221 / 7e-76 ARABIDOPSIS CYTOCHROME B5 ISOFORM B, cytochrome B5 isoform B (.1) Potri.012G024600 [exp] 109 / 1e-31 AT5G53560 163 / 5e-53 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Potri.001G314200 [exp] 109 / 1e-31 AT2G32720 199 / 3e-67 ARABIDOPSIS CYTOCHROME B5 ISOFORM B, cytochrome B5 isoform B (.1) Potri.017G054300 [exp] 107 / 4e-31 AT2G32720 221 / 6e-76 ARABIDOPSIS CYTOCHROME B5 ISOFORM B, cytochrome B5 isoform B (.1) Potri.015G007600 [exp] 103 / 2e-29 AT5G53560 153 / 8e-49 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Potri.014G019200 [exp] 85 / 6e-22 AT5G48810 115 / 8e-34 ARABIDOPSIS CYTOCHROME B5 ISOFORM D, cytochrome B5 isoform D (.1) Potri.002G088600 [exp] 79 / 4e-18 AT1G77760 1394 / 0.0 nitrate reductase 1 (.1) Potri.005G172400 [exp] 79 / 7e-18 AT1G37130 1400 / 0.0 CHLORATE RESISTANT 3, ARABIDOPSIS NITRATE REDUCTASE 2, nitrate reductase 2 (.1) Potri.018G087600 [exp] 69 / 3e-16 AT1G60660 155 / 4e-50 ARABIDOPSIS CYTOCHROME B5-LIKE PROTEIN, cytochrome B5-like protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000651 [exp] 171 / 6e-56 AT1G26340 194 / 7e-65 ARABIDOPSIS CYTOCHROME B5 ISOFORM A, cytochrome B5 isoform A (.1) Lus10036973 [exp] 167 / 1e-54 AT1G26340 193 / 8e-65 ARABIDOPSIS CYTOCHROME B5 ISOFORM A, cytochrome B5 isoform A (.1) Lus10022794 [exp] 112 / 9e-33 AT2G32720 211 / 1e-71 ARABIDOPSIS CYTOCHROME B5 ISOFORM B, cytochrome B5 isoform B (.1) Lus10011858 [exp] 110 / 4e-32 AT2G32720 211 / 5e-72 ARABIDOPSIS CYTOCHROME B5 ISOFORM B, cytochrome B5 isoform B (.1) Lus10008838 [exp] 107 / 1e-30 AT5G53560 232 / 3e-80 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Lus10022357 [exp] 106 / 2e-30 AT5G53560 231 / 2e-79 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Lus10043137 [exp] 105 / 6e-30 AT2G32720 218 / 2e-74 ARABIDOPSIS CYTOCHROME B5 ISOFORM B, cytochrome B5 isoform B (.1) Lus10032612 [exp] 105 / 6e-30 AT2G32720 218 / 2e-74 ARABIDOPSIS CYTOCHROME B5 ISOFORM B, cytochrome B5 isoform B (.1) Lus10030219 [exp] 95 / 9e-26 AT5G53560 151 / 4e-48 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Lus10005992 [exp] 94 / 3e-25 AT5G53560 144 / 2e-45 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00173 [poplar] [flax] Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
Representative CDS sequence Show only first row Show all	>Potri.010G156900.1 pacid=42798270 polypeptide=Potri.010G156900.1.p locus=Potri.010G156900 ID=Potri.010G156900.1.v4.1 annot-version=v4.1 ATGCCGACCCTGACGAAGCTGTACACGATGCAAGAGGCAGCCCAACACAACACTCCTCAAGATTGCTGGGTCGTTATTGATGGCAAGGTTTATGATGTGG GTTCATACTTGGATGAGCACCCTGGTGGAGATGATGTTATCCTTGCTACAACTGGCAAAGATGCAACGGATGAATTTGAAGATGCGGGGCACAGCAAAAG CGCCAGAGAGCAATTAGAAACCTTTTTCATTGGTGAGCTTGACCTGTCTGCCACAGTTATCCCAGAACTTGAAATCTCCTCCAAGAAACAAGCAGATTAT ACCCAGAAGCTCAAGGATTTGACAAAGCAATACTGGGCAGTTTCTGTAGCCATTGCTGGTGTCTCAGTGGTTGGCTTCTTGTACTTACGCAAGAAGTAG
AA sequence Show only first row Show all	>Potri.010G156900.1 pacid=42798270 polypeptide=Potri.010G156900.1.p locus=Potri.010G156900 ID=Potri.010G156900.1.v4.1 annot-version=v4.1 MPTLTKLYTMQEAAQHNTPQDCWVVIDGKVYDVGSYLDEHPGGDDVILATTGKDATDEFEDAGHSKSAREQLETFFIGELDLSATVIPELEISSKKQADY TQKLKDLTKQYWAVSVAIAGVSVVGFLYLRKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G26340		B5 #6, B5#6, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Potri.010G156900 [exp]	0	1	B5.2
AT1G03330			Small nuclear ribonucleoprotei...		Potri.004G219000 [exp]	2.64	0.7927
AT5G53045			unknown protein		Potri.015G011500 [exp]	6.63	0.7300
AT3G49470		NACA2	nascent polypeptide-associated...		Potri.015G003300 [exp]	8.36	0.7447
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Potri.015G070600 [exp]	8.94	0.7686	ALDH10.2
AT2G47790			Transducin/WD40 repeat-like su...		Potri.002G205600 [exp]	12.00	0.7502
AT5G19440			NAD(P)-binding Rossmann-fold s...		Potri.009G057500 [exp]	16.61	0.7075	CCR.8
AT5G11880			Pyridoxal-dependent decarboxyl...		Potri.009G119300 [exp]	17.54	0.7374
AT2G40070			unknown protein		Potri.016G114900 [exp]	18.02	0.7238
AT3G05740		RECQI1	RECQ helicase l1 (.1)		Potri.005G019800 [exp]	19.07	0.7044
AT1G06110		SKIP16	SKP1/ASK-interacting protein 1...		Potri.017G027000 [exp]	19.23	0.6972

Compare expression of checked genes

Potri.010G156900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.