Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18650 128 / 4e-37 PDCB3 plasmodesmata callose-binding protein 3 (.1) AT2G03505 125 / 2e-36 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G13830 119 / 2e-33 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G69295 106 / 2e-28 PDCB4 plasmodesmata callose-binding protein 4 (.1) AT5G61130 105 / 3e-28 PDCB1 plasmodesmata callose-binding protein 1 (.1) AT5G08000 97 / 4e-25 PDCB2, E13L3 PLASMODESMATA CALLOSE-BINDING PROTEIN 2, "glucan endo-1,3-beta-glucosidase-like protein 3", glucan endo-1,3-beta-glucosidase-like protein 3 (.1) AT1G26450 92 / 6e-23 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G11820 95 / 2e-22 O-Glycosyl hydrolases family 17 protein (.1.2) AT4G13600 86 / 2e-20 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G01630 87 / 1e-19 O-Glycosyl hydrolases family 17 protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G095300 [exp] 177 / 1e-56 AT1G18650 140 / 2e-42 plasmodesmata callose-binding protein 3 (.1) Potri.015G057800 [exp] 121 / 3e-34 AT1G18650 151 / 3e-46 plasmodesmata callose-binding protein 3 (.1) Potri.012G065750 [exp] 117 / 1e-32 AT1G18650 142 / 1e-42 plasmodesmata callose-binding protein 3 (.1) Potri.017G055700 [exp] 97 / 9e-25 AT4G13600 152 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G006100 [exp] 99 / 9e-24 AT1G11820 805 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.004G010500 [exp] 99 / 9e-24 AT1G11820 794 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.001G315700 [exp] 92 / 7e-23 AT4G13600 155 / 2e-47 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.014G164600 [exp] 84 / 9e-21 AT5G35740 179 / 8e-60 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.004G153800 [exp] 88 / 3e-20 AT4G34480 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026662 [exp] 148 / 2e-44 AT1G18650 145 / 2e-43 plasmodesmata callose-binding protein 3 (.1) Lus10004650 [exp] 147 / 5e-44 AT1G18650 141 / 4e-42 plasmodesmata callose-binding protein 3 (.1) Lus10037071 [exp] 145 / 1e-43 AT1G18650 138 / 3e-41 plasmodesmata callose-binding protein 3 (.1) Lus10036914 [exp] 145 / 3e-43 AT1G18650 139 / 2e-41 plasmodesmata callose-binding protein 3 (.1) Lus10021157 [exp] 121 / 4e-34 AT1G18650 157 / 7e-49 plasmodesmata callose-binding protein 3 (.1) Lus10040522 [exp] 121 / 8e-34 AT1G18650 158 / 7e-49 plasmodesmata callose-binding protein 3 (.1) Lus10034690 [exp] 122 / 9e-34 AT1G18650 157 / 8e-48 plasmodesmata callose-binding protein 3 (.1) Lus10021619 [exp] 116 / 9e-32 AT1G18650 151 / 1e-45 plasmodesmata callose-binding protein 3 (.1) Lus10032601 [exp] 94 / 9e-24 AT4G13600 167 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10010478 [exp] 92 / 2e-21 AT3G20650 570 / 0.0 mRNA capping enzyme family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [poplar] [flax] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Potri.010G158900.2 pacid=42796951 polypeptide=Potri.010G158900.2.p locus=Potri.010G158900 ID=Potri.010G158900.2.v4.1 annot-version=v4.1 ATGGCTGTTTTAGTGTTTTTAGGTCTTTTCTTGGCCCTCACTGGCCATTCAAGTGCTACTTACTGCATATGCAAGGATGGGGTTGGTGACACACAGCTGC AAAAGAGCCTGGATTATGCTTGTGGAGCCGGAGCTGACTGTACCCAAATCATTCAAAATGCCCCTTGTTACCAGCCCAACACTGTAAAAGATCACTGCAG CTATGCTGTTAACAGCTACTTCCAGAAGAAGGGCCAAGCTGTTGGGAGCTGTGATTTTTCAGGAACTGCCATGACTAGCGCCACTCCCCCTCAAAGTGTA GCCTCTGGGTGTACATATCCTGCATCTGCAACTCCAAGCACAGGGACAGGCAACACCCCAACAACCACCACTCCAAGCACAGGCACAACACCCACCGGCA CAGGCACAACACCTACAGGCACAGGCACCGGCACCAGCACAGGCACAGGCACAGGCACAGGCACAGGCACAGGCACACCTTCATCTATAATTCCTACCCC GCCTTCATCAGTGTTCAACTCAGGATTGGGCCCAACTGGTTTCAATGATAATAGTAGTGAGGCTCCTGCTTTTAAGGGCACTAACTTGTGGTTCATTGCA TCTTTGACCCTCTTGTTTTCAGGCATATTTTTGTTCTGGGGTTGA
AA sequence Show only first row Show all	>Potri.010G158900.2 pacid=42796951 polypeptide=Potri.010G158900.2.p locus=Potri.010G158900 ID=Potri.010G158900.2.v4.1 annot-version=v4.1 MAVLVFLGLFLALTGHSSATYCICKDGVGDTQLQKSLDYACGAGADCTQIIQNAPCYQPNTVKDHCSYAVNSYFQKKGQAVGSCDFSGTAMTSATPPQSV ASGCTYPASATPSTGTGNTPTTTTPSTGTTPTGTGTTPTGTGTGTSTGTGTGTGTGTGTPSSIIPTPPSSVFNSGLGPTGFNDNSSEAPAFKGTNLWFIA SLTLLFSGIFLFWG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Potri.010G158900 [exp]	0	1
AT2G41900	C3HZnF	OXS2	OXIDATIVE STRESS 2, CCCH-type ...		Potri.006G053800 [exp]	4.58	0.7470
AT1G34130		STT3B	staurosporin and temperature s...		Potri.012G036300 [exp]	6.32	0.7028	Pt-STT3.2
AT4G16650			O-fucosyltransferase family pr...		Potri.001G157400 [exp]	13.78	0.7439
AT5G62580			ARM repeat superfamily protein...		Potri.012G074400 [exp]	23.87	0.7368
AT5G61790		CNX1, ATCNX1	calnexin 1 (.1)		Potri.012G111100 [exp]	36.05	0.6808	CNX1.2
AT4G22580			Exostosin family protein (.1)		Potri.001G120800 [exp]	42.42	0.6022
AT3G10200			S-adenosyl-L-methionine-depend...		Potri.006G043600 [exp]	42.77	0.6440
AT1G74340		DPMS2, DPMS	dolichol phosphate mannose syn...		Potri.003G095701 [exp]	58.33	0.6264
AT5G10020			Leucine-rich receptor-like pro...		Potri.005G083000 [exp]	65.86	0.6602
AT2G39870			unknown protein		Potri.008G062200 [exp]	85.71	0.6420

Compare expression of checked genes

Potri.010G158900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.