Potri.010G159650 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.010G159650.1 pacid=42799165 polypeptide=Potri.010G159650.1.p locus=Potri.010G159650 ID=Potri.010G159650.1.v4.1 annot-version=v4.1
ATGAACAGGCTTTCTCTATGCGAAAGAACAATCAAAGCACAACACAACCATGACTCTTTCTCTTTTCTCTCTCCAAAGTATCTCTTATTTGTTTTAGTGT
TGAAGTTGGAGGAGAATTCCATGCATGGAAGCAAAATATTGAAAAGGGAAGAAAAGATAGGCAGCAGGTGCACTCAATTGAGAACCATTCGGTGTGGGAT
TTGGACGGTCAAGATCAACTGCGACTTTTGGGGATCCCAAGGAATGAGGATTTTAGTAGATACTACATTAACAACCAGCAACTCTCTGACTGCAGAGCCA
CAGAAGCATCCAAACTCTCAATATGCCTTACCGTGTCTTTGCTTATACAAGTGA
AA sequence
>Potri.010G159650.1 pacid=42799165 polypeptide=Potri.010G159650.1.p locus=Potri.010G159650 ID=Potri.010G159650.1.v4.1 annot-version=v4.1
MNRLSLCERTIKAQHNHDSFSFLSPKYLLFVLVLKLEENSMHGSKILKREEKIGSRCTQLRTIRCGIWTVKINCDFWGSQGMRILVDTTLTTSNSLTAEP
QKHPNSQYALPCLCLYK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G159650 0 1
Potri.007G020732 1.00 0.9289
AT1G03670 ankyrin repeat family protein ... Potri.011G133300 3.00 0.8593
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Potri.007G050000 3.74 0.8937
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Potri.008G064000 3.87 0.8922 LAC2.1,LAC2
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Potri.002G026100 5.00 0.8778
AT1G22730 MA3 domain-containing protein ... Potri.005G199200 6.48 0.8632
AT2G23360 Plant protein of unknown funct... Potri.007G046100 8.12 0.8747
AT1G20270 2-oxoglutarate (2OG) and Fe(II... Potri.002G016700 8.94 0.8571
Potri.002G239451 10.95 0.8594
AT4G02680 EOL1 ETO1-like 1 (.1) Potri.005G214400 11.09 0.8013

Potri.010G159650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.