Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G03430 356 / 7e-126 Ankyrin repeat family protein (.1) AT3G04710 86 / 3e-19 TPR10 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3) AT5G02620 82 / 7e-18 ATANK1, ANK1 ankyrin-like1 (.1) AT4G35450 80 / 1e-17 AKR2A, AFT, AKR2 ankyrin repeat-containing protein 2 (.1.2.3.4.5) AT4G19150 79 / 3e-17 Ankyrin repeat family protein (.1.2) AT1G07710 80 / 4e-17 Ankyrin repeat family protein (.1) AT5G20350 80 / 5e-17 TIP1 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) AT3G02850 80 / 7e-17 SKOR STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) AT5G66055 79 / 7e-17 EMB16, EMB2036, AKRP EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) AT5G37500 79 / 2e-16 GORK gated outwardly-rectifying K+ channel, gated outwardly-rectifying K+ channel (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G213200 [exp] 97 / 6e-23 AT2G03430 96 / 2e-22 Ankyrin repeat family protein (.1) Potri.013G062000 [exp] 92 / 3e-21 AT2G03430 94 / 2e-21 Ankyrin repeat family protein (.1) Potri.010G185200 [exp] 90 / 1e-20 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.013G042300 [exp] 89 / 5e-20 AT3G04710 619 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3) Potri.007G145200 [exp] 86 / 5e-19 AT2G31820 751 / 0.0 Ankyrin repeat family protein (.1) Potri.005G054800 [exp] 85 / 6e-19 AT3G04710 611 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3) Potri.003G103400 [exp] 82 / 1e-18 AT4G19150 234 / 2e-77 Ankyrin repeat family protein (.1.2) Potri.001G130500 [exp] 81 / 4e-18 AT4G19150 222 / 1e-72 Ankyrin repeat family protein (.1.2) Potri.018G121200 [exp] 80 / 6e-17 AT5G20350 951 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037116 [exp] 325 / 8e-114 AT2G03430 284 / 2e-97 Ankyrin repeat family protein (.1) Lus10036968 [exp] 236 / 4e-79 AT2G03430 216 / 7e-72 Ankyrin repeat family protein (.1) Lus10006559 [exp] 91 / 9e-21 AT3G04710 581 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3) Lus10003260 [exp] 89 / 5e-20 AT3G04710 587 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3) Lus10003748 [exp] 85 / 1e-18 AT1G07710 83 / 6e-18 Ankyrin repeat family protein (.1) Lus10014522 [exp] 83 / 2e-18 AT5G40160 322 / 3e-109 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1) Lus10038108 [exp] 83 / 7e-18 AT5G20350 839 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) Lus10003986 [exp] 80 / 7e-17 AT3G09550 831 / 0.0 Ankyrin repeat family protein (.1) Lus10001414 [exp] 77 / 8e-17 AT4G19150 245 / 9e-82 Ankyrin repeat family protein (.1.2) Lus10015687 [exp] 80 / 9e-17 AT3G02850 1231 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [poplar] [flax] Ank PF12796 [poplar] [flax] Ank_2 Ankyrin repeats (3 copies) CL0465 [poplar] [flax] Ank PF13637 [poplar] [flax] Ank_4 Ankyrin repeats (many copies)
Representative CDS sequence Show only first row Show all	>Potri.010G161300.7 pacid=42798919 polypeptide=Potri.010G161300.7.p locus=Potri.010G161300 ID=Potri.010G161300.7.v4.1 annot-version=v4.1 ATGGACATGGACATGGACATCGATCCTCCAAGCCAAATCAAAGACAAAGACCTTTTCAAGGCAGCAGAGACAGGCGATTCTTCGACATTCAAATCGCTTC CACCAGAACGCCTCTCCAAAGCCCTCTCTCTCCAAAACGACGACGGGCGCTCTGTCCTCCATGTCGCCGCCTCTTCTGGACACCCTGAGGTGGTGAAAAT ACTATCAGATATTGATCAATCAAGTAGCGCAGTGGTAAATGGTAAAGATGAGGAAGGTTGGGCCCCACTTCATTCTGCTGCTAGCATCGGAAATGTTGAG ATTGTTGAAATTCTGTTAAGCAAAGGAGCTGATGTTAATTTGAAAAATGATGGCGGGCGCGCTGCTCTTCACTATGCTGCTAGCAAGGGATGGTTGAAGA TTGCTCAACTTTTGATCTCGCATGGTGCAAAGATCAATATCAAAGACAAGGTTGGTTGTACTCCGTTGCATCGAGCAGCAAGTACAGGGAACTCAGAGTT GTGTGAACTCTTAATCGAGGAAGGAGCAGAGGTTGATGCTGTTGATAAAGCTGATCAAACTCCTCTCATGAGTGCAATTATTTGCAATAACAAAGAGGTG GCTCTCCTTCTAATTCGACATGGAGCAGATGTGGATGTGGAAGACAAGGAAGGATACACCGTGCTGGGTCGAGCTTCGGAAGACTTTAGGCCAATTCTGA TTGATGCTGCTAAGGCTATGCTTGAAGGATGA
AA sequence Show only first row Show all	>Potri.010G161300.7 pacid=42798919 polypeptide=Potri.010G161300.7.p locus=Potri.010G161300 ID=Potri.010G161300.7.v4.1 annot-version=v4.1 MDMDMDIDPPSQIKDKDLFKAAETGDSSTFKSLPPERLSKALSLQNDDGRSVLHVAASSGHPEVVKILSDIDQSSSAVVNGKDEEGWAPLHSAASIGNVE IVEILLSKGADVNLKNDGGRAALHYAASKGWLKIAQLLISHGAKINIKDKVGCTPLHRAASTGNSELCELLIEEGAEVDAVDKADQTPLMSAIICNNKEV ALLLIRHGADVDVEDKEGYTVLGRASEDFRPILIDAAKAMLEG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G03430			Ankyrin repeat family protein ...		Potri.010G161300 [exp]	0	1
AT1G76400			Ribophorin I (.1)		Potri.002G006600 [exp]	9.89	0.8912
AT5G26360			TCP-1/cpn60 chaperonin family ...		Potri.018G138200 [exp]	11.13	0.8891
AT5G57300			S-adenosyl-L-methionine-depend...		Potri.018G088400 [exp]	12.64	0.8853
AT2G15790		CYP40, SQN	SQUINT, CYCLOPHILIN 40, peptid...		Potri.007G040100 [exp]	12.96	0.8853
AT5G55940		EMB2731	embryo defective 2731, Unchara...		Potri.001G370000 [exp]	12.96	0.8843
AT4G33250		ATTIF3K1, EIF3K	eukaryotic translation initiat...		Potri.006G136500 [exp]	13.63	0.8853	TIF3.2
AT5G08500			Transmembrane CLPTM1 family pr...		Potri.018G137500 [exp]	21.63	0.8648
AT2G17220		Kin3	kinase 3, Protein kinase super...		Potri.006G072100 [exp]	28.84	0.8569
AT5G27470			seryl-tRNA synthetase / serine...		Potri.005G094400 [exp]	32.15	0.8632
AT1G55900		TIM50, EMB1860	embryo defective 1860, Haloaci...		Potri.001G364500 [exp]	37.94	0.8362

Compare expression of checked genes

Potri.010G161300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.