Potri.010G168300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26800 195 / 4e-63 RING/U-box superfamily protein (.1)
AT1G14200 135 / 5e-40 RING/U-box superfamily protein (.1)
AT3G13430 98 / 2e-24 RING/U-box superfamily protein (.1.2.3)
AT5G56340 99 / 4e-24 ATCRT1 RING/U-box superfamily protein (.1)
AT3G19950 97 / 7e-24 RING/U-box superfamily protein (.1)
AT3G46620 90 / 7e-21 zinc finger (C3HC4-type RING finger) family protein (.1)
AT1G55530 89 / 9e-21 RING/U-box superfamily protein (.1)
AT1G60360 87 / 5e-20 RING/U-box superfamily protein (.1)
AT2G03000 87 / 9e-20 RING/U-box superfamily protein (.1)
AT5G59550 86 / 1e-19 zinc finger (C3HC4-type RING finger) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G087200 336 / 2e-118 AT1G26800 194 / 6e-63 RING/U-box superfamily protein (.1)
Potri.019G032500 105 / 1e-26 AT5G56340 177 / 1e-51 RING/U-box superfamily protein (.1)
Potri.003G223200 101 / 5e-25 AT5G56340 301 / 3e-99 RING/U-box superfamily protein (.1)
Potri.004G122000 95 / 1e-24 AT1G26800 94 / 1e-24 RING/U-box superfamily protein (.1)
Potri.013G060500 97 / 6e-24 AT1G55530 207 / 2e-64 RING/U-box superfamily protein (.1)
Potri.005G090500 95 / 4e-23 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1)
Potri.001G001500 95 / 9e-23 AT5G56340 323 / 2e-108 RING/U-box superfamily protein (.1)
Potri.007G074014 92 / 4e-22 AT3G19950 278 / 5e-93 RING/U-box superfamily protein (.1)
Potri.015G028400 92 / 8e-22 AT3G19950 256 / 2e-83 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012819 190 / 9e-61 AT1G26800 182 / 6e-58 RING/U-box superfamily protein (.1)
Lus10030464 179 / 3e-56 AT1G26800 181 / 3e-57 RING/U-box superfamily protein (.1)
Lus10037170 150 / 1e-45 AT1G26800 128 / 5e-37 RING/U-box superfamily protein (.1)
Lus10036757 150 / 1e-45 AT1G26800 127 / 1e-36 RING/U-box superfamily protein (.1)
Lus10002637 112 / 4e-29 AT1G55530 257 / 4e-82 RING/U-box superfamily protein (.1)
Lus10020258 112 / 3e-28 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3)
Lus10013397 99 / 5e-24 AT5G56340 330 / 5e-111 RING/U-box superfamily protein (.1)
Lus10010179 91 / 9e-22 AT3G19950 285 / 6e-96 RING/U-box superfamily protein (.1)
Lus10022967 86 / 5e-20 AT1G60360 153 / 3e-45 RING/U-box superfamily protein (.1)
Lus10028063 85 / 3e-19 AT1G60360 224 / 9e-71 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.010G168300.1 pacid=42798757 polypeptide=Potri.010G168300.1.p locus=Potri.010G168300 ID=Potri.010G168300.1.v4.1 annot-version=v4.1
ATGGCCTCTGAGACTGAATTTCCTGCCGAGTTTTCTTCTATGTTTGAGAGGCTTTTAAGGCATAGGGACCTCTCTTTGTTCTTACCTTTTATTTTAGGGT
TCACCTCCACCAACACCACAGAGCAACGTGACCCAGATCAAGAAGCACCACAAACAACAGACCCAAATGAAAGAATCATCCTTATAAACCCTTTCACTCA
AGGCATGGTGGTGATTGAAGGAGCCGCAAGTCTTGAATCTTTACTTAGAGACATAGGTAACAAGAAGGGCCAACCACCAGCCTCCAAAGCATCCATAGAG
GCCATGCCAAAAGTGGAGATAGGGGAAGATAATAAAGATGGTGAGTGTGCTATCTGTTTAGAGGAGTGGGAGCTTGGTGGCGTAGTAAAGGAGATGCCTT
GTAAGCATAGGTTCCACGGTGGTTGTGTAGAGAAGTGGTTAAAGATTCATGGGAATTGCCCTGTTTGTAGGTACAAGATGCCTGTTGACGAGGAGGAACT
GGGGAAGAAAAGAGATGAGGGAGATGGAGGGAGAGAGAGGAGAGTTGAAAGAGAGATTTGGGTTAGTTTTGCTTTTAATGGTAGCAGGAGAAATGGGGAT
TCAAATGAAAACCCTTCAAATGATTCTTCTACGGAGGATCAAGAGAGATTTTTGTAA
AA sequence
>Potri.010G168300.1 pacid=42798757 polypeptide=Potri.010G168300.1.p locus=Potri.010G168300 ID=Potri.010G168300.1.v4.1 annot-version=v4.1
MASETEFPAEFSSMFERLLRHRDLSLFLPFILGFTSTNTTEQRDPDQEAPQTTDPNERIILINPFTQGMVVIEGAASLESLLRDIGNKKGQPPASKASIE
AMPKVEIGEDNKDGECAICLEEWELGGVVKEMPCKHRFHGGCVEKWLKIHGNCPVCRYKMPVDEEELGKKRDEGDGGRERRVEREIWVSFAFNGSRRNGD
SNENPSNDSSTEDQERFL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G26800 RING/U-box superfamily protein... Potri.010G168300 0 1
AT5G28460 Pentatricopeptide repeat (PPR)... Potri.014G090400 2.82 0.9427
Potri.014G059200 6.24 0.8983
Potri.006G055100 6.48 0.8962
AT4G30480 TPR1, AtTPR1 tetratricopeptide repeat 1, Te... Potri.006G178900 7.07 0.9100
AT1G18260 HRD3A, EBS5 EMS-mutagenized bri1 suppresso... Potri.015G038100 7.14 0.9174
AT5G05410 AP2_ERF DREB2A DEHYDRATION-RESPONSIVE ELEMENT... Potri.010G183700 9.00 0.9353 Pt-DREB2.2
AT5G20620 UBQ4 ubiquitin 4 (.1) Potri.006G129600 11.31 0.9328 SUBI.10
AT4G30480 TPR1, AtTPR1 tetratricopeptide repeat 1, Te... Potri.018G100700 11.40 0.8655
AT2G20560 DNAJ heat shock family protein... Potri.007G136700 13.41 0.9154
AT2G20880 AP2_ERF AtERF53 ERF domain 53, Integrase-type ... Potri.019G102200 16.12 0.9098

Potri.010G168300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.