Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	S.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26820 147 / 1e-45 RNS3 ribonuclease 3 (.1) AT2G02990 139 / 6e-42 RNS1, ATRNS1 ribonuclease 1 (.1) AT1G14220 138 / 6e-42 Ribonuclease T2 family protein (.1) AT1G14210 104 / 2e-28 Ribonuclease T2 family protein (.1) AT2G39780 60 / 2e-11 RNS2 ribonuclease 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G086800 [exp] 193 / 2e-63 AT1G26820 288 / 1e-99 ribonuclease 3 (.1) Potri.008G086700 [exp] 148 / 1e-45 AT2G02990 310 / 8e-108 ribonuclease 1 (.1) Potri.010G168700 [exp] 143 / 8e-44 AT2G02990 337 / 2e-118 ribonuclease 1 (.1) Potri.006G118200 [exp] 50 / 3e-09 AT2G02990 86 / 3e-22 ribonuclease 1 (.1) Potri.014G174400 [exp] 53 / 5e-09 AT2G39780 371 / 5e-131 ribonuclease 2 (.1.2) Potri.013G134400 [exp] 38 / 0.0009 AT2G02990 82 / 4e-18 ribonuclease 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027978 [exp] 152 / 2e-47 AT1G14220 330 / 4e-116 Ribonuclease T2 family protein (.1) Lus10030468 [exp] 139 / 4e-42 AT2G02990 341 / 3e-120 ribonuclease 1 (.1) Lus10012823 [exp] 138 / 1e-41 AT2G02990 334 / 2e-117 ribonuclease 1 (.1) Lus10003110 [exp] 66 / 1e-13 AT1G26820 142 / 4e-42 ribonuclease 3 (.1) Lus10035881 [exp] 63 / 8e-13 AT2G02990 130 / 4e-37 ribonuclease 1 (.1) Lus10035882 [exp] 63 / 9e-13 AT1G14220 128 / 1e-36 Ribonuclease T2 family protein (.1) Lus10015409 [exp] 46 / 2e-06 AT1G14220 79 / 8e-18 Ribonuclease T2 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00445 [poplar] [flax] Ribonuclease_T2 Ribonuclease T2 family
Representative CDS sequence Show only first row Show all	>Potri.010G168600.1 pacid=42799889 polypeptide=Potri.010G168600.1.p locus=Potri.010G168600 ID=Potri.010G168600.1.v4.1 annot-version=v4.1 ATGAGCAGTTTGCAGAAGGATTGGCCATCACTGTCCTGCCCCAGCAGCGACGGCTTCAGGTTTTGGTCACATGAATGGATAAAGCATGGTACCTGTGCAG TGTCAGAAGAGATTGGCCAGCACGTTTATTTTGAAGCTGCTCTTAAGCTGAAAAAAAAGGCAAACCTTCTCCAAGCTCTTATAAGTGCAGGAATTAAACC AGACGGTGAATCTTATGACCTGGACAGCATAAGATTAGCTATAAAAGAAGCTACAGGATTTACTCCTGACATAGAATGCAACACCGATGCATCCAAGAAT AGGCAGGTGTATCAGGTTTTCATGTGCGCAGACATTTCCGGGTCGGAATTCATAGAATGTCCGGTGCCACTGAAGAAAAGATGTAAATCTAATAAGGTCC ATTTCCCTGAGTTCTAG
AA sequence Show only first row Show all	>Potri.010G168600.1 pacid=42799889 polypeptide=Potri.010G168600.1.p locus=Potri.010G168600 ID=Potri.010G168600.1.v4.1 annot-version=v4.1 MSSLQKDWPSLSCPSSDGFRFWSHEWIKHGTCAVSEEIGQHVYFEAALKLKKKANLLQALISAGIKPDGESYDLDSIRLAIKEATGFTPDIECNTDASKN RQVYQVFMCADISGSEFIECPVPLKKRCKSNKVHFPEF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G26820		RNS3	ribonuclease 3 (.1)		Potri.010G168600 [exp]	0	1	S.1
AT1G77860		KOM	KOMPEITO, Rhomboid-related int...		Potri.002G090400 [exp]	16.97	0.8102	KOM.1
					Potri.006G127750 [exp]	20.49	0.8215
AT3G58610			ketol-acid reductoisomerase (....		Potri.013G117532 [exp]	21.35	0.8037
AT1G67950			RNA-binding (RRM/RBD/RNP motif...		Potri.010G103600 [exp]	30.62	0.8027
AT2G30490		REF3, CYP73A5, ...	REDUCED EPRDERMAL FLUORESCENCE...		Potri.006G078101 [exp]	41.02	0.7960
AT5G20635		AGG3	Arabidopsis G protein gamma su...		Potri.018G062400 [exp]	45.66	0.7914
AT4G17740			Peptidase S41 family protein (...		Potri.010G063400 [exp]	46.43	0.7920
AT3G08900		RGP3	reversibly glycosylated polype...		Potri.015G060300 [exp]	46.64	0.7873	RGP3.3
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Potri.004G002400 [exp]	47.62	0.7598
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Potri.004G109800 [exp]	49.47	0.7941

Compare expression of checked genes

Potri.010G168600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.