Potri.010G170050 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62280 135 / 1e-38 SLAH1 SLAC1 homologue 1 (.1)
AT1G62262 132 / 1e-37 SLAH4 SLAC1 homologue 4 (.1)
AT1G12480 110 / 2e-28 SLAC1, RCD3, CDI3, OZS1 SLOW ANION CHANNEL-ASSOCIATED 1, RADICAL-INDUCED CELL DEATH 3, OZONE-SENSITIVE 1, CARBON DIOXIDE INSENSITIVE 3, C4-dicarboxylate transporter/malic acid transport protein (.1)
AT5G24030 86 / 5e-20 SLAH3 SLAC1 homologue 3 (.1)
AT4G27970 81 / 4e-18 SLAH2 SLAC1 homologue 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G114300 81 / 2e-18 AT1G12480 432 / 4e-149 SLOW ANION CHANNEL-ASSOCIATED 1, RADICAL-INDUCED CELL DEATH 3, OZONE-SENSITIVE 1, CARBON DIOXIDE INSENSITIVE 3, C4-dicarboxylate transporter/malic acid transport protein (.1)
Potri.015G026700 63 / 2e-12 AT5G24030 367 / 3e-124 SLAC1 homologue 3 (.1)
Potri.002G227800 0 / 1 AT1G62280 120 / 7e-31 SLAC1 homologue 1 (.1)
Potri.008G084901 0 / 1 AT1G62280 117 / 3e-32 SLAC1 homologue 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024306 137 / 2e-39 AT1G62280 349 / 7e-119 SLAC1 homologue 1 (.1)
Lus10015133 127 / 6e-35 AT1G62280 387 / 6e-133 SLAC1 homologue 1 (.1)
Lus10007023 101 / 2e-25 AT1G12480 720 / 0.0 SLOW ANION CHANNEL-ASSOCIATED 1, RADICAL-INDUCED CELL DEATH 3, OZONE-SENSITIVE 1, CARBON DIOXIDE INSENSITIVE 3, C4-dicarboxylate transporter/malic acid transport protein (.1)
Lus10006678 100 / 6e-25 AT1G12480 734 / 0.0 SLOW ANION CHANNEL-ASSOCIATED 1, RADICAL-INDUCED CELL DEATH 3, OZONE-SENSITIVE 1, CARBON DIOXIDE INSENSITIVE 3, C4-dicarboxylate transporter/malic acid transport protein (.1)
Lus10027553 91 / 1e-21 AT5G24030 669 / 0.0 SLAC1 homologue 3 (.1)
Lus10039312 89 / 9e-21 AT5G24030 670 / 0.0 SLAC1 homologue 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03595 SLAC1 Voltage-dependent anion channel
Representative CDS sequence
>Potri.010G170050.1 pacid=42800022 polypeptide=Potri.010G170050.1.p locus=Potri.010G170050 ID=Potri.010G170050.1.v4.1 annot-version=v4.1
ATGCCAGCCCAAAGATCTCGATTCGAGATTGAGCTAATAACCAACCCCTCGAGCATCATTGTGGACAGAATCAAGCCATCCCCAGTGTCCATCTTAACAA
AGTTTCACGCTGGTTATTTTAGGATTGGCCTATCTCTAGGTGGCCGAGCTTTACCCTCTGCACCATATGTTGCGCTGCTCCACCCTGCAGGATTTCTTGT
GCTGTGGTCTCTTGCTTTCCTAATCCTTACTTCACTTTCTTTTCTTTACATATTGAGATGCATGTTTTTCTTCAAGGTGGTGGAAACCGAATTCTGGCAT
CTGGCACTTGATGTTAAAATTTATGGCCAATGGTTCTCTAAAGGAAAGAGGTTTCTGTCAACTTTTGCAAATCCAACAAGCCAGTTATCAGTAATTGGAA
ACTTGGTTGGTGCTCAAGCTGCAGCTAAGATGGGGTGGAAAGAGATTGCTATTTTCTTGTTTTCCCCTGGCATGGTCCATTATTTGGTGCTGTTTGTACA
CTTATCAGCGCTGATCTGA
AA sequence
>Potri.010G170050.1 pacid=42800022 polypeptide=Potri.010G170050.1.p locus=Potri.010G170050 ID=Potri.010G170050.1.v4.1 annot-version=v4.1
MPAQRSRFEIELITNPSSIIVDRIKPSPVSILTKFHAGYFRIGLSLGGRALPSAPYVALLHPAGFLVLWSLAFLILTSLSFLYILRCMFFFKVVETEFWH
LALDVKIYGQWFSKGKRFLSTFANPTSQLSVIGNLVGAQAAAKMGWKEIAIFLFSPGMVHYLVLFVHLSALI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G62280 SLAH1 SLAC1 homologue 1 (.1) Potri.010G170050 0 1
AT2G43770 Transducin/WD40 repeat-like su... Potri.019G096900 3.00 0.8859
AT3G48150 CDC23, APC8 anaphase-promoting complex sub... Potri.010G248550 3.74 0.8480
AT3G56690 CIP111 Cam interacting protein 111 (.... Potri.016G032666 4.89 0.8435
AT3G26410 TRM11, AtTRM11 tRNA modification 11, methyltr... Potri.001G207000 6.48 0.8598
Potri.005G152000 7.34 0.8690
AT3G09040 Pentatricopeptide repeat (PPR)... Potri.005G137900 10.19 0.8537
AT4G27000 ATRBP45C RNA-binding (RRM/RBD/RNP motif... Potri.011G138400 11.74 0.8489
AT5G56780 ATET2 ARABIDOPSIS EFFECTOR OF TRANSC... Potri.006G150000 16.24 0.8409
AT3G12810 CHR13, SRCAP, P... PHOTOPERIOD-INDEPENDENT EARLY ... Potri.012G057601 18.97 0.8413
AT1G51200 A20/AN1-like zinc finger famil... Potri.003G205500 19.97 0.8265

Potri.010G170050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.