Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20620 45 / 1e-06 UBQ4 ubiquitin 4 (.1) AT4G05050 44 / 1e-06 UBQ11 ubiquitin 11 (.1.2.3.4) AT4G02890 44 / 1e-06 UBQ14 Ubiquitin family protein (.1.2.3.4) AT3G62250 44 / 1e-06 UBQ5 ubiquitin 5 (.1) AT5G37640 43 / 4e-06 UBQ9 ubiquitin 9 (.1) AT2G47110 42 / 5e-06 UBQ6 ubiquitin 6 (.1.2) AT2G36170 41 / 8e-06 Ubiquitin supergroup;Ribosomal protein L40e (.1) AT5G03240 41 / 2e-05 UBQ3 polyubiquitin 3 (.1.2.3) AT1G55060 41 / 2e-05 UBQ12 ubiquitin 12 (.1) AT1G65350 40 / 6e-05 UBQ13 ubiquitin 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G021500 [exp] 45 / 7e-07 AT4G02890 604 / 0.0 Ubiquitin family protein (.1.2.3.4) Potri.017G036800 [exp] 45 / 8e-07 AT4G05320 753 / 0.0 polyubiquitin 10 (.1.2.3.4.5.6) Potri.017G135600 [exp] 45 / 9e-07 AT4G02890 597 / 0.0 Ubiquitin family protein (.1.2.3.4) Potri.006G129600 [exp] 44 / 2e-06 AT5G20620 600 / 0.0 ubiquitin 4 (.1) Potri.007G123300 [exp] 44 / 3e-06 AT4G05320 753 / 0.0 polyubiquitin 10 (.1.2.3.4.5.6) Potri.016G077200 [exp] 42 / 3e-06 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.016G077000 [exp] 42 / 4e-06 AT3G52590 194 / 1e-65 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.015G111500 [exp] 42 / 7e-06 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.001G418500 [exp] 42 / 7e-06 AT4G05320 753 / 0.0 polyubiquitin 10 (.1.2.3.4.5.6)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030894 [exp] 44 / 2e-06 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10018367 [exp] 44 / 2e-06 AT4G05320 452 / 4e-164 polyubiquitin 10 (.1.2.3.4.5.6) Lus10030595 [exp] 42 / 8e-06 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10008873 [exp] 37 / 0.0003 AT3G52590 261 / 5e-92 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G170801.1 pacid=42797525 polypeptide=Potri.010G170801.1.p locus=Potri.010G170801 ID=Potri.010G170801.1.v4.1 annot-version=v4.1 ATGCAAGTTACAGTCAGCAAGAGTCCTGCCATTCTCGAGCGTCTTCATAAAAAATTTGCATTTCACCTCGGAGGCGAAAGACCAAGTGAAGAGTGGGACT CCTTTTGGATACGGGCCGCTTTCAAGCTGTTTCCCTGCGAAGATAAGCCTTTGCTGATCCGGTGGGATCCCTTCCTTGTCCCAGATCTTGGCCTTGACAT TATCAGAGCTTTCGACCCCCAACATTATAAAAATAGACAGAACGAGTGA
AA sequence Show only first row Show all	>Potri.010G170801.1 pacid=42797525 polypeptide=Potri.010G170801.1.p locus=Potri.010G170801 ID=Potri.010G170801.1.v4.1 annot-version=v4.1 MQVTVSKSPAILERLHKKFAFHLGGERPSEEWDSFWIRAAFKLFPCEDKPLLIRWDPFLVPDLGLDIIRAFDPQHYKNRQNE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G05050		UBQ11	ubiquitin 11 (.1.2.3.4)		Potri.010G170801 [exp]	0	1
AT1G32400		TOM2A	tobamovirus multiplication 2A ...		Potri.001G146100 [exp]	1.73	0.7328	Pt-TOM2.2
AT3G28470	MYB	TDF1, ATMYB35	DEFECTIVE IN MERISTEM DEVELOPM...		Potri.017G075000 [exp]	18.70	0.6941
AT3G03010			Peptidyl-tRNA hydrolase II (PT...		Potri.013G082850 [exp]	23.66	0.6624
AT2G27230	bHLH	LHW, bHLH156	LONESOME HIGHWAY, transcriptio...		Potri.016G101801 [exp]	25.00	0.7028
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G116170 [exp]	33.40	0.6237
					Potri.009G013701 [exp]	36.59	0.6670
AT1G77060			Phosphoenolpyruvate carboxylas...		Potri.002G073600 [exp]	40.02	0.6814
AT5G61060		HDA5, HDA05, AT...	histone deacetylase 5 (.1.2)		Potri.004G092900 [exp]	45.59	0.5725
					Potri.006G071801 [exp]	46.47	0.6067
AT5G15120			Protein of unknown function (D...		Potri.013G064200 [exp]	51.64	0.6463

Compare expression of checked genes

Potri.010G170801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.