Potri.010G175800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06130 80 / 7e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
AT5G19090 76 / 3e-15 Heavy metal transport/detoxification superfamily protein (.1.2.3)
AT3G05220 73 / 3e-14 Heavy metal transport/detoxification superfamily protein (.1.2)
AT1G23000 63 / 3e-11 Heavy metal transport/detoxification superfamily protein (.1)
AT5G27690 60 / 5e-10 Heavy metal transport/detoxification superfamily protein (.1)
AT3G04900 55 / 7e-09 Heavy metal transport/detoxification superfamily protein (.1)
AT1G56210 56 / 8e-09 Heavy metal transport/detoxification superfamily protein (.1)
AT1G66240 51 / 3e-08 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3)
AT3G56240 50 / 8e-08 ATX1, CCH copper chaperone (.1)
AT2G28660 52 / 1e-07 Chloroplast-targeted copper chaperone protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G175801 181 / 1e-57 ND /
Potri.008G202800 78 / 6e-16 AT3G06130 150 / 6e-41 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.008G128400 74 / 8e-15 AT1G23000 137 / 1e-36 Heavy metal transport/detoxification superfamily protein (.1)
Potri.010G114300 74 / 9e-15 AT1G23000 128 / 2e-33 Heavy metal transport/detoxification superfamily protein (.1)
Potri.002G206900 59 / 5e-10 AT5G27690 111 / 3e-28 Heavy metal transport/detoxification superfamily protein (.1)
Potri.008G023800 56 / 5e-10 AT1G66240 124 / 7e-39 homolog of anti-oxidant 1 (.1.2.3)
Potri.001G326100 59 / 7e-10 AT3G04900 66 / 8e-13 Heavy metal transport/detoxification superfamily protein (.1)
Potri.009G126600 58 / 1e-09 AT3G04900 70 / 3e-14 Heavy metal transport/detoxification superfamily protein (.1)
Potri.010G236500 54 / 2e-09 AT1G66240 129 / 1e-40 homolog of anti-oxidant 1 (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032445 71 / 1e-13 AT1G23000 129 / 2e-34 Heavy metal transport/detoxification superfamily protein (.1)
Lus10041228 71 / 2e-13 AT3G06130 149 / 3e-41 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10029942 65 / 2e-11 AT5G19090 125 / 1e-31 Heavy metal transport/detoxification superfamily protein (.1.2.3)
Lus10004465 63 / 7e-11 AT5G19090 122 / 2e-30 Heavy metal transport/detoxification superfamily protein (.1.2.3)
Lus10028529 59 / 6e-10 AT1G23000 81 / 4e-17 Heavy metal transport/detoxification superfamily protein (.1)
Lus10043444 55 / 3e-09 AT1G66240 127 / 4e-39 homolog of anti-oxidant 1 (.1.2.3)
Lus10009116 57 / 1e-08 AT2G02000 248 / 3e-75 glutamate decarboxylase 3 (.1)
Lus10015174 55 / 2e-08 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1)
Lus10031514 55 / 3e-08 AT5G19090 118 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1.2.3)
Lus10028859 52 / 4e-08 AT1G66240 125 / 8e-38 homolog of anti-oxidant 1 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Potri.010G175800.1 pacid=42799886 polypeptide=Potri.010G175800.1.p locus=Potri.010G175800 ID=Potri.010G175800.1.v4.1 annot-version=v4.1
ATGGAACGTGAGCCGTTTGCTCCTTCAGTTGCTCCTCAGACATGTGTCCTGAAAATGAATTTTGCATGTGGAAATTGCCACAAGAAGATCAGGAAACAAT
TGCAGAAAACTCAAGGTGTGCACTCCATCCACATAGATGCGAATGAGGGGAAGGTGACAGTCTCAAGTACAGTAGACCCTCATGTACTTATAGAAGAGTT
TGCAAAGATTGGGAAGAAAGCACATCTTCTATGGGAACCAAGACCTCTCTTGATGAACCAAAACAATGCTGATAACAGAGGTAAGAGAGTTCAAGATGCA
CCTTTTATTGCTCAACAAAATGGAATCGATCTCGATCAGCTGGCTCAACTGCAAAAATTCGCTGAGAATAAAAGCTTGAAACTTTTGGAGCTAAACCAAA
CCAACAACATAAAGATGACCTTCAGTGACAACGGTGTTATCAGTCATAGTGATCATGCCACAGACATCAATACAAACAATTTGCACGAGCTTAAAGGGAG
TAATGGAGCTATGAATGGGCACAACCCACCACCTATGAATACATTTGGTCAAGGCCAATATGGTAATATCGGTGGTGCGAGCAGCAGCAGAGGTCCTGCT
CCCTCTGGTAATGGTAGTGGTGGATGTGATCCCACAACGAAAAATGTACCTCCTTGTTGCCACGCTTTTGAGTTCAGCTGTGGCGGCAATAGATGGGGTG
AGGAGAAGGCTCAAAGGCCTCTACTGCCACCCAACTGTGATCCTACTGGTCCCATGCCAACATACAACCATGGTCCTTACGGCGCAACACCACCAAATCA
CTATGCTCCTCATGGATCGCAACCGGTGAATATCCTACACGCAGATGTAAACTGTGGTGGGGGTCATAAAACTTGCCGGGTGATGTGA
AA sequence
>Potri.010G175800.1 pacid=42799886 polypeptide=Potri.010G175800.1.p locus=Potri.010G175800 ID=Potri.010G175800.1.v4.1 annot-version=v4.1
MEREPFAPSVAPQTCVLKMNFACGNCHKKIRKQLQKTQGVHSIHIDANEGKVTVSSTVDPHVLIEEFAKIGKKAHLLWEPRPLLMNQNNADNRGKRVQDA
PFIAQQNGIDLDQLAQLQKFAENKSLKLLELNQTNNIKMTFSDNGVISHSDHATDINTNNLHELKGSNGAMNGHNPPPMNTFGQGQYGNIGGASSSRGPA
PSGNGSGGCDPTTKNVPPCCHAFEFSCGGNRWGEEKAQRPLLPPNCDPTGPMPTYNHGPYGATPPNHYAPHGSQPVNILHADVNCGGGHKTCRVM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G06130 Heavy metal transport/detoxifi... Potri.010G175800 0 1
Potri.010G175801 1.41 0.7086
AT4G27290 S-locus lectin protein kinase ... Potri.001G414200 18.38 0.6920
AT5G24910 ELA1, CYP714A1 EUI-like p450 A1, cytochrome P... Potri.008G026300 28.98 0.6240
AT5G18980 ARM repeat superfamily protein... Potri.008G200500 38.15 0.6296
AT5G21930 ATHMA8, HMA8, P... ARABIDOPSIS HEAVY METAL ATPASE... Potri.018G047800 39.39 0.6539
AT4G11220 RTNLB2, BTI2 Reticulan like protein B2, VIR... Potri.013G160900 42.42 0.6112
AT4G34131 UGT73B3 UDP-glucosyl transferase 73B3 ... Potri.002G123700 43.68 0.6429
AT3G22250 UDP-Glycosyltransferase superf... Potri.016G019400 46.58 0.6402
AT5G07610 F-box family protein (.1) Potri.013G109900 60.54 0.6332
AT5G04020 calmodulin binding (.1) Potri.016G041100 81.33 0.6060

Potri.010G175800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.