Potri.010G182150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.010G182150.1 pacid=42798063 polypeptide=Potri.010G182150.1.p locus=Potri.010G182150 ID=Potri.010G182150.1.v4.1 annot-version=v4.1
ATGCATGTTGAACCGAACTCAGACTGCATAATCCTATTACATAATTCTGCTGTGAGTATTCACGTTGCAAATTTGAGATTGTCTGTACGATGTCATGTCT
GTGTGATTACCATGGGTCGATCTCTATGCTTCAGGACCTTGTTCTGTGTAGCTACTAGCTGGGAATTGATCTTTCTTTCCATTCTACAGAGTACAGACCA
ATTCACCACCAATTTTTCAGTTGCCATGTTAAAATAA
AA sequence
>Potri.010G182150.1 pacid=42798063 polypeptide=Potri.010G182150.1.p locus=Potri.010G182150 ID=Potri.010G182150.1.v4.1 annot-version=v4.1
MHVEPNSDCIILLHNSAVSIHVANLRLSVRCHVCVITMGRSLCFRTLFCVATSWELIFLSILQSTDQFTTNFSVAMLK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G182150 0 1
AT1G69380 RRG RETARDED ROOT GROWTH, Protein ... Potri.008G092400 1.00 0.8980
AT5G10830 S-adenosyl-L-methionine-depend... Potri.005G067500 2.82 0.8563
Potri.009G092750 3.16 0.8830
AT3G07510 unknown protein Potri.014G176400 3.74 0.8258
AT1G56440 TPR5 tetratricopeptide repeat 5, Te... Potri.013G008400 4.47 0.8536
AT1G07350 SR45a serine/arginine rich-like prot... Potri.001G248100 8.94 0.8419
AT2G24640 UBP19 ubiquitin-specific protease 19... Potri.018G009500 13.41 0.8317
AT5G17260 NAC ANAC086 NAC domain containing protein ... Potri.012G023900 14.69 0.8413
AT4G19645 TRAM, LAG1 and CLN8 (TLC) lipi... Potri.002G056600 14.96 0.8243
AT3G45430 Concanavalin A-like lectin pro... Potri.009G035601 18.00 0.8000

Potri.010G182150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.