Potri.010G182200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10985 124 / 6e-38 WI12, ATWI-12, SAG20 ARABIDOPSIS THALIANA WOUND-INDUCED PROTEIN 12, senescence associated gene 20 (.1)
AT5G01740 65 / 5e-14 Nuclear transport factor 2 (NTF2) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G075200 183 / 3e-61 AT3G10985 131 / 5e-41 ARABIDOPSIS THALIANA WOUND-INDUCED PROTEIN 12, senescence associated gene 20 (.1)
Potri.019G125900 94 / 2e-25 AT3G10985 93 / 9e-25 ARABIDOPSIS THALIANA WOUND-INDUCED PROTEIN 12, senescence associated gene 20 (.1)
Potri.013G153801 92 / 6e-24 AT3G10985 88 / 3e-22 ARABIDOPSIS THALIANA WOUND-INDUCED PROTEIN 12, senescence associated gene 20 (.1)
Potri.016G129500 77 / 1e-18 AT5G01740 179 / 2e-58 Nuclear transport factor 2 (NTF2) family protein (.1)
Potri.016G129600 73 / 2e-17 AT5G01740 179 / 2e-58 Nuclear transport factor 2 (NTF2) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017421 124 / 1e-36 AT5G01740 115 / 2e-32 Nuclear transport factor 2 (NTF2) family protein (.1)
Lus10010223 122 / 4e-33 AT5G17680 218 / 6e-58 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10001261 66 / 8e-14 AT5G01740 139 / 1e-41 Nuclear transport factor 2 (NTF2) family protein (.1)
Lus10022755 59 / 1e-11 AT5G01740 135 / 5e-40 Nuclear transport factor 2 (NTF2) family protein (.1)
Lus10029439 57 / 1e-10 AT5G01740 128 / 3e-37 Nuclear transport factor 2 (NTF2) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0051 NTF2 PF07107 WI12 Wound-induced protein WI12
Representative CDS sequence
>Potri.010G182200.1 pacid=42797186 polypeptide=Potri.010G182200.1.p locus=Potri.010G182200 ID=Potri.010G182200.1.v4.1 annot-version=v4.1
ATGATGCGCCTTCTTACTGGTGAACAAAAAGACAACGACGTGCCGTTTGACTTCTCCCCTATCTCCATCACCTCTTTTGGAAACCTTGTGGTTGTTGAAG
GGTGTAATACAAGTCGTTCCATTTCCTGGGTGCACGCTTGGACTGTTACGGATGGGATAATTACCCAGGTTAGAGAGTACTTCAATACTTCTCTTACTGT
TACTCGTCTTGGAAACCAATCACAACCGTCTGATTTTAAGTCAAAGTCAAATTCATCATCAACGCCCGAAATATCTCTGTTGCATTGCCCATCCATCTGG
GAGAGCACCCTATCCAATCGGGTCGGTAAGTCCGTGCCGGGTTTGGTTCTGGCTATTTGA
AA sequence
>Potri.010G182200.1 pacid=42797186 polypeptide=Potri.010G182200.1.p locus=Potri.010G182200 ID=Potri.010G182200.1.v4.1 annot-version=v4.1
MMRLLTGEQKDNDVPFDFSPISITSFGNLVVVEGCNTSRSISWVHAWTVTDGIITQVREYFNTSLTVTRLGNQSQPSDFKSKSNSSSTPEISLLHCPSIW
ESTLSNRVGKSVPGLVLAI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G10985 WI12, ATWI-12, ... ARABIDOPSIS THALIANA WOUND-IND... Potri.010G182200 0 1
AT4G20820 FAD-binding Berberine family p... Potri.001G464800 11.87 0.7859
AT4G27950 AP2_ERF CRF4 cytokinin response factor 4 (.... Potri.013G158500 12.72 0.7587
AT2G29420 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, ... Potri.010G061301 15.68 0.7789
AT4G29190 C3HZnF AtOZF2 Arabidopsis thaliana oxidation... Potri.006G234300 23.87 0.7567
AT1G68630 PLAC8 family protein (.1) Potri.010G127800 27.71 0.7749
AT5G06800 GARP myb-like HTH transcriptional r... Potri.001G228500 29.89 0.7774
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.002G128000 33.61 0.7680
AT3G13110 SAT-M, SAT-A, S... SERINE ACETYLTRANSFERASE 3, SE... Potri.001G365500 34.94 0.7275
Potri.008G045133 59.44 0.7419
AT4G35220 Cyclase family protein (.1) Potri.009G097201 71.77 0.6544

Potri.010G182200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.