Potri.010G182400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05360 136 / 2e-41 unknown protein
AT2G38450 124 / 5e-37 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G075000 170 / 1e-55 AT2G38450 123 / 1e-37 unknown protein
Potri.016G128700 127 / 3e-38 AT2G38450 144 / 2e-45 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001262 134 / 6e-41 AT2G38450 137 / 2e-42 unknown protein
Lus10012213 130 / 3e-39 AT5G05360 138 / 2e-42 unknown protein
PFAM info
Representative CDS sequence
>Potri.010G182400.1 pacid=42799342 polypeptide=Potri.010G182400.1.p locus=Potri.010G182400 ID=Potri.010G182400.1.v4.1 annot-version=v4.1
ATGGGAAAGTCACTTCCTTCCACGGGCAAACTCCTGGAACTCTCCAAAATAGTCTCTTCACACAAACCAAGACACAAAAGAAGCATCGTACCCGTTGTTC
CATCGCGGCCGAGTGAGGTCCGGGTTGACTCGGAGCGATTGAAGGTGAAAAAGATGGAAGAAAGTTCTCTTATTTTGGATGGCCAAAAACGGGTGCCATT
AGGCCAGGTTGTCTCTGATTGTGCTAAAAGATGGTTTGAAGATACACTAAAGGAAGCAAAGACTGGTGACATTTCCATGCAAGTTCTTGTGGGTCAGATG
TATTTTAATGGCTATGGCGTCCCTAAAGATGTTGAAAAGGGAAGTGCTTGGATTAGTAGAGCTTCAAAACGTCGAGCTTCAGTATGGAAAGTAAGCAATA
AACGTCCAGGTTATAATGGAAGTGACTCAGATTCAGAGGATGACAGGAAATAA
AA sequence
>Potri.010G182400.1 pacid=42799342 polypeptide=Potri.010G182400.1.p locus=Potri.010G182400 ID=Potri.010G182400.1.v4.1 annot-version=v4.1
MGKSLPSTGKLLELSKIVSSHKPRHKRSIVPVVPSRPSEVRVDSERLKVKKMEESSLILDGQKRVPLGQVVSDCAKRWFEDTLKEAKTGDISMQVLVGQM
YFNGYGVPKDVEKGSAWISRASKRRASVWKVSNKRPGYNGSDSDSEDDRK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G38450 unknown protein Potri.010G182400 0 1
AT4G02820 Pentatricopeptide repeat (PPR)... Potri.005G208900 1.00 0.7256
AT2G45520 unknown protein Potri.014G072400 9.74 0.6832
AT5G62610 bHLH bHLH079 basic helix-loop-helix (bHLH) ... Potri.015G068100 12.24 0.6824
AT5G62190 PRH75 DEAD box RNA helicase (PRH75) ... Potri.012G131000 12.24 0.6898 Pt-PRH75.1
AT1G04850 ubiquitin-associated (UBA)/TS-... Potri.017G056900 12.40 0.6673
AT4G22140 EBS EARLY BOLTING IN SHORT DAYS, P... Potri.006G270601 12.80 0.6434
AT2G39170 unknown protein Potri.008G035000 15.58 0.6781
AT2G03500 GARP Homeodomain-like superfamily p... Potri.009G106600 17.97 0.6657
AT4G13530 unknown protein Potri.013G099200 24.89 0.6615
AT1G67910 unknown protein Potri.008G186200 25.61 0.6787

Potri.010G182400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.