Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05365 86 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1) AT1G66240 56 / 2e-10 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT3G56240 50 / 2e-08 ATX1, CCH copper chaperone (.1) AT3G56891 49 / 2e-07 Heavy metal transport/detoxification superfamily protein (.1) AT5G19090 48 / 9e-07 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT3G06130 43 / 3e-05 Heavy metal transport/detoxification superfamily protein (.1.2) AT1G71050 41 / 6e-05 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT5G27690 42 / 8e-05 Heavy metal transport/detoxification superfamily protein (.1) AT5G02600 39 / 0.0006 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT2G37390 39 / 0.0007 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G236500 [exp] 57 / 3e-11 AT1G66240 129 / 1e-40 homolog of anti-oxidant 1 (.1.2.3) Potri.008G023800 [exp] 52 / 2e-09 AT1G66240 124 / 7e-39 homolog of anti-oxidant 1 (.1.2.3) Potri.019G106500 [exp] 47 / 5e-07 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G107500 [exp] 47 / 7e-07 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G026100 [exp] 44 / 2e-05 AT5G27690 100 / 3e-24 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G132000 [exp] 43 / 3e-05 AT5G27690 114 / 4e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 42 / 3e-05 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G024700 [exp] 43 / 4e-05 AT5G27690 114 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.008G202800 [exp] 41 / 0.0001 AT3G06130 150 / 6e-41 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040965 [exp] 96 / 4e-26 AT5G05365 117 / 2e-36 Heavy metal transport/detoxification superfamily protein (.1) Lus10009848 [exp] 93 / 4e-25 AT5G05365 115 / 2e-35 Heavy metal transport/detoxification superfamily protein (.1) Lus10028859 [exp] 50 / 8e-08 AT1G66240 125 / 8e-38 homolog of anti-oxidant 1 (.1.2.3) Lus10019789 [exp] 46 / 1e-06 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10014120 [exp] 46 / 1e-06 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10043444 [exp] 45 / 1e-06 AT1G66240 127 / 4e-39 homolog of anti-oxidant 1 (.1.2.3) Lus10024435 [exp] 45 / 1e-05 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10025294 [exp] 44 / 2e-05 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10031495 [exp] 43 / 5e-05 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1) Lus10015174 [exp] 43 / 6e-05 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.010G182700.2 pacid=42799897 polypeptide=Potri.010G182701.1.p locus=Potri.010G182700 ID=Potri.010G182700.2.v4.1 annot-version=v4.1 ATGCTTTTTTGCCGACCCCATGTGTGGACACAGTCTTTCCTCTCAAGTCAACACCATGGAAACAAAGGCAGCTTTATCATAAAATGTGATAAATTCCATC AATCAAGTAAAGAATCCAATGCCCCTCTCAACTTGCTCATTAATTTATATGCTTCAAGTACTGGTCACTTTGCCAACATTGATGTTTGTTTCCTTATTTC TCTTCCTCTTGATTTCCTCTCTTTATTTCTCTTCCAGTGCACTATTCACGCCAATTTCACCAACTTGCAGTTTTCATCGAACAGAATGGCTAACGTGGTG GAATTGAAAGTGGGTTTGCATTGCGATGAATGTATTAAGAAGATATTGAAAGCTATCAAAAAAATACAAGACATCGAAACTTACGACATTGATACACAGC TCAATAAGGTCACAGTGACTGGCAATGTTTCATCAGAAGAAGTCATTAGAGTTATTCACAAGATTGGGAAGACAGCGACCACTTGGGAAGCCGAGGGAGA TGGGGTAACTTGCTAA
AA sequence Show only first row Show all	>Potri.010G182700.2 pacid=42799897 polypeptide=Potri.010G182701.1.p locus=Potri.010G182700 ID=Potri.010G182700.2.v4.1 annot-version=v4.1 MLFCRPHVWTQSFLSSQHHGNKGSFIIKCDKFHQSSKESNAPLNLLINLYASSTGHFANIDVCFLISLPLDFLSLFLFQCTIHANFTNLQFSSNRMANVV ELKVGLHCDECIKKILKAIKKIQDIETYDIDTQLNKVTVTGNVSSEEVIRVIHKIGKTATTWEAEGDGVTC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G05365			Heavy metal transport/detoxifi...		Potri.010G182700 [exp]	0	1
AT1G47655	DOF		Dof-type zinc finger DNA-bindi...		Potri.014G036600 [exp]	10.95	0.6843
AT3G04620		DAN1	D NUCLDUO1-ACTIVATEEIC ACID BI...		Potri.005G056000 [exp]	16.94	0.6691
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Potri.003G134500 [exp]	17.66	0.6792
					Potri.016G011250 [exp]	21.77	0.7357
AT4G31140			O-Glycosyl hydrolases family 1...		Potri.006G280700 [exp]	22.38	0.7559
AT2G31270		ATCDT1A, CDT1A,...	ARABIDOPSIS HOMOLOG OF YEAST C...		Potri.002G040100 [exp]	22.71	0.6672
AT3G26935			DHHC-type zinc finger family p...		Potri.015G101900 [exp]	25.69	0.6557
AT5G58530			Glutaredoxin family protein (....		Potri.008G072200 [exp]	31.17	0.6492
AT1G31320	AS2	LBD4	LOB domain-containing protein ...		Potri.005G097800 [exp]	36.85	0.7335
					Potri.008G057732 [exp]	37.21	0.7373

Compare expression of checked genes

Potri.010G182700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.