Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05450 114 / 7e-31 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G71370 107 / 4e-28 DEA(D/H)-box RNA helicase family protein (.1) AT1G71280 104 / 2e-27 DEA(D/H)-box RNA helicase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G073100 [exp] 151 / 4e-44 AT5G05450 837 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040952 [exp] 120 / 8e-33 AT5G05450 640 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10009838 [exp] 82 / 3e-19 AT5G05450 721 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF13959 [poplar] [flax] DUF4217 Domain of unknown function (DUF4217)
Representative CDS sequence Show only first row Show all	>Potri.010G184132.1 pacid=42799900 polypeptide=Potri.010G184132.1.p locus=Potri.010G184132 ID=Potri.010G184132.1.v4.1 annot-version=v4.1 ATGATACACATGATGTTATTCCTCAGGTACGATCTGCTGCCAAAAAGGACCATGATGTCATGGAGAAAGGACTGTGGAGAAAGGATTGAGAGCATATGTT TCTTACATTCATGCAGTGCATATAAAGATCACCACTGCTCTTACATTTTCAGTTGGAAAGAACTTGAAGTTGGGAAGTTGGGCATGGGATATGGCTTATT GCAGCTCCCATCGATGCCTGAGGTAAAGCACTACTCGCTTTCAACCAAGGGTTTCACTCCAGTTGATGACGTCAATTTAGAGGAGATCAAGTACAAGGAT AAATCTAGTGAGAAGAAAAGGCAGAAAGATTTGCAAGCAAAGAAAGAAGCACAGCAGTGA
AA sequence Show only first row Show all	>Potri.010G184132.1 pacid=42799900 polypeptide=Potri.010G184132.1.p locus=Potri.010G184132 ID=Potri.010G184132.1.v4.1 annot-version=v4.1 MIHMMLFLRYDLLPKRTMMSWRKDCGERIESICFLHSCSAYKDHHCSYIFSWKELEVGKLGMGYGLLQLPSMPEVKHYSLSTKGFTPVDDVNLEEIKYKD KSSEKKRQKDLQAKKEAQQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G05450			P-loop containing nucleoside t...		Potri.010G184132 [exp]	0	1
					Potri.010G019550 [exp]	4.47	0.8135
AT5G53180		ATPTB2	polypyrimidine tract-binding p...		Potri.015G020800 [exp]	4.89	0.7754
AT2G38280		ATAMPD, FAC1	EMBRYONIC FACTOR1, ADENOSINE 5...		Potri.010G034800 [exp]	6.32	0.7956
AT1G22110			structural constituent of ribo...		Potri.002G092000 [exp]	10.72	0.7922
AT1G23540		IGI1, AtPERK12	proline-rich extensin-like rec...		Potri.008G189700 [exp]	10.95	0.7139
					Potri.014G175100 [exp]	10.95	0.7617
					Potri.003G014056 [exp]	12.48	0.7964
AT1G34270			Exostosin family protein (.1)		Potri.013G116200 [exp]	12.72	0.7484
AT3G43240	ARID		ARID/BRIGHT DNA-binding domain...		Potri.018G064500 [exp]	16.24	0.7567
AT1G11060			WAPL (Wings apart-like protein...		Potri.004G039900 [exp]	18.24	0.7163

Compare expression of checked genes

Potri.010G184132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.