Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05600 511 / 0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G55970 502 / 2e-179 ATJRG21 jasmonate-regulated gene 21 (.1) AT3G11180 496 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT2G38240 426 / 7e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G22880 235 / 7e-75 TT18, TDS4, ANS, LDOX TANNIN DEFICIENT SEED 4, ANTHOCYANIDIN SYNTHASE, leucoanthocyanidin dioxygenase (.1.2) AT1G17020 234 / 2e-74 ATSRG1, SRG1 senescence-related gene 1 (.1) AT4G10490 230 / 5e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10500 227 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 226 / 4e-71 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17010 226 / 5e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G069300 [exp] 669 / 0 AT5G05600 528 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.016G117100 [exp] 515 / 0 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 510 / 0 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101100 [exp] 506 / 0 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 241 / 3e-77 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G382400 [exp] 240 / 8e-77 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.001G355100 [exp] 238 / 7e-76 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.011G024100 [exp] 238 / 9e-76 AT4G16330 419 / 7e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G119100 [exp] 235 / 1e-74 AT4G22880 530 / 0.0 TANNIN DEFICIENT SEED 4, ANTHOCYANIDIN SYNTHASE, leucoanthocyanidin dioxygenase (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004387 [exp] 510 / 0 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10005037 [exp] 489 / 4e-174 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004808 [exp] 471 / 2e-167 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027807 [exp] 347 / 2e-119 AT5G05600 330 / 1e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030185 [exp] 239 / 3e-76 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10037292 [exp] 239 / 9e-76 AT4G16330 416 / 5e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10028068 [exp] 237 / 9e-76 AT5G08640 429 / 1e-151 flavonol synthase 1 (.1.2) Lus10022292 [exp] 238 / 1e-75 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1) Lus10011979 [exp] 236 / 3e-75 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1) Lus10011980 [exp] 233 / 6e-74 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.010G188000.1 pacid=42797726 polypeptide=Potri.010G188000.1.p locus=Potri.010G188000 ID=Potri.010G188000.1.v4.1 annot-version=v4.1 ATGAATAAGCTCCAAGATTGGCCCGAACCTATAGTCCGAGTACAATCCTTGTCCGATAGCGGCATACCCCTAATTCCAGAGCGATATGTCAAGCCCATAC TTCAGAGGCCATCCGTAAATCCCACCACTTCGAATGATGTGAACATCCCTGTCATTGATCTTGCCAGGCTATATGGTGATGATCATGCTCTTCGAGCCAC AATACTTGACCAAATCTCAATAGCATGCCGGGAGTGGGGATTTTTTCAAGTTATTAACCATGGTGTTAGCCCTCAATTGATGGACCGTGCTCGAGAAGTA TGGAGACAATTCTTTCATTCGCCCATGGAGGTTAAGCAAGCTTATGCAAACACACCCAAGACTTATGAAGGTTATGGTAGCCGGTTAGGGGTTGAAAAAG GTGCGATTCTTGATTGGAGTGATTACTACTTCCTGCACTATCTTCCTTTACCATTGAAGGACTATAACAAATGGCCTGCCATTACAGCTGATTGCAGGGC AGTTCTTGATGAATATGGTAAGCAATTGGTGGAGCTGTGTGGGAAGTTAATGAAGGTTTTATCAATAAACCTTGGATTAGGAGAGGAACAACTTCAAAAT GCCTTTGGTGGAGAAAATATCGGGGCATGCCTAAGAGTTAATTTTTACCCTAAATGTCCACAGCCTGACCTGACCCTTGGCTTATCGTCACATTCGGATC CCGGTGGCATGACCCTTCTCTTGCCGGACAGTAATGTCCCTGGTCTTCAAGTCCGTAAAGATGGGAATTGGATCACTGTAAAGCCAGTTCCACATGCTTT TATTGTTAATATTGGTGATCAAATTCAGGTGCTAAGCAATGCAACTTGCAAGAGCGTGGAGCACAGAGTGATGGTAAATTCATCAGAAGAGCGTCTCTCT CTTGCTTTCTTCTACAATCCAAGGAGTGATATACCCATAGAGCCTTTGAAGGAGCTCGTGGCACCAGACAGGCCTCCACTCTATCCAGCCATGACATTCG ACGAGTACAGGCTCTTCATAAGAATGAGGGGTCCCTGTGGAAAATCCCAAGTGGAGTCCCTGAAATCTCCAAGATGA
AA sequence Show only first row Show all	>Potri.010G188000.1 pacid=42797726 polypeptide=Potri.010G188000.1.p locus=Potri.010G188000 ID=Potri.010G188000.1.v4.1 annot-version=v4.1 MNKLQDWPEPIVRVQSLSDSGIPLIPERYVKPILQRPSVNPTTSNDVNIPVIDLARLYGDDHALRATILDQISIACREWGFFQVINHGVSPQLMDRAREV WRQFFHSPMEVKQAYANTPKTYEGYGSRLGVEKGAILDWSDYYFLHYLPLPLKDYNKWPAITADCRAVLDEYGKQLVELCGKLMKVLSINLGLGEEQLQN AFGGENIGACLRVNFYPKCPQPDLTLGLSSHSDPGGMTLLLPDSNVPGLQVRKDGNWITVKPVPHAFIVNIGDQIQVLSNATCKSVEHRVMVNSSEERLS LAFFYNPRSDIPIEPLKELVAPDRPPLYPAMTFDEYRLFIRMRGPCGKSQVESLKSPR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G05600			2-oxoglutarate (2OG) and Fe(II...		Potri.010G188000 [exp]	0	1
AT2G26530		AR781	Protein of unknown function (D...		Potri.014G034900 [exp]	2.00	0.9360	AR781.2
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Potri.005G223100 [exp]	4.00	0.9352
AT2G26190			calmodulin-binding family prot...		Potri.006G147900 [exp]	4.89	0.9232
AT1G30760			FAD-binding Berberine family p...		Potri.011G159400 [exp]	4.89	0.9348
AT2G41180		SIB2	sigma factor binding protein 2...		Potri.019G013300 [exp]	5.29	0.9305
AT4G33520		AtHMAC6, HMA6, ...	Arabidopsis thaliana heavy met...		Potri.001G205400 [exp]	5.29	0.9038
AT1G30760			FAD-binding Berberine family p...		Potri.011G160900 [exp]	5.91	0.9194
AT1G59870		ATABCG36, ABCG3...	PENETRATION 3, ARABIDOPSIS PLE...		Potri.001G189500 [exp]	6.24	0.9078
AT3G50900			unknown protein		Potri.007G022300 [exp]	7.41	0.9131
AT5G47710			Calcium-dependent lipid-bindin...		Potri.016G005300 [exp]	8.36	0.9235

Compare expression of checked genes

Potri.010G188000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.