Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40110 224 / 4e-77 Yippee family putative zinc-binding protein (.1.2) AT3G11230 192 / 2e-64 Yippee family putative zinc-binding protein (.1.2) AT3G08990 181 / 2e-60 Yippee family putative zinc-binding protein (.1.2) AT3G55890 170 / 5e-56 Yippee family putative zinc-binding protein (.1) AT5G53940 155 / 4e-50 Yippee family putative zinc-binding protein (.1) AT4G27745 123 / 1e-37 Yippee family putative zinc-binding protein (.1) AT4G27740 88 / 1e-23 Yippee family putative zinc-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G067100 [exp] 258 / 8e-90 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2) Potri.011G115700 [exp] 154 / 1e-49 AT5G53940 187 / 1e-62 Yippee family putative zinc-binding protein (.1) Potri.016G115000 [exp] 146 / 5e-46 AT3G11230 154 / 2e-49 Yippee family putative zinc-binding protein (.1.2) Potri.001G085400 [exp] 125 / 4e-38 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.015G009200 [exp] 124 / 5e-38 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.012G019100 [exp] 124 / 6e-38 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1) Potri.003G145400 [exp] 122 / 5e-37 AT4G27745 179 / 3e-60 Yippee family putative zinc-binding protein (.1) Potri.006G015500 [exp] 119 / 1e-35 AT3G08990 122 / 6e-37 Yippee family putative zinc-binding protein (.1.2) Potri.014G101600 [exp] 114 / 4e-34 AT4G27745 154 / 2e-50 Yippee family putative zinc-binding protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028300 [exp] 234 / 5e-81 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2) Lus10040190 [exp] 232 / 2e-80 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2) Lus10035531 [exp] 177 / 2e-58 AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2) Lus10027762 [exp] 176 / 4e-58 AT2G40110 173 / 4e-57 Yippee family putative zinc-binding protein (.1.2) Lus10015416 [exp] 145 / 7e-46 AT5G53940 169 / 1e-55 Yippee family putative zinc-binding protein (.1) Lus10013992 [exp] 142 / 5e-45 AT5G53940 157 / 1e-50 Yippee family putative zinc-binding protein (.1) Lus10033226 [exp] 125 / 2e-38 AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1) Lus10000335 [exp] 124 / 1e-37 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1) Lus10007773 [exp] 122 / 3e-37 AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1) Lus10023244 [exp] 103 / 2e-29 AT4G27740 124 / 2e-38 Yippee family putative zinc-binding protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [poplar] [flax] Beta-tent PF03226 [poplar] [flax] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Potri.010G190000.2 pacid=42797132 polypeptide=Potri.010G190000.2.p locus=Potri.010G190000 ID=Potri.010G190000.2.v4.1 annot-version=v4.1 ATGGGCAGGCTGTTTGTAGAGAGTCTTGAAGGGAGGATCTATAGTTGCAAGCACTGCAGGACTCATCTTGCTCTTTATGATGATATTGTTTCAAAGTCTT TCCACTGCAGGCATGGGAAAGCTTATCTCTTCAAGAAGGTAGTGAACGTCTTTGTGGGAGAGAAGGAAGAGAGAATCATGATTACCGGGCTGCATACTGT TGCTGACATTTTCTGTGTTGGGTGTGGATCAATTGTGGGCTGGAAATATGAGACTGCACATGAAAAGAGCCAGAAGTACAAGGAAGGAAAATCTGTCCTT GAGCGGTTTAAGGTGTCTGGTCCCGACGGAAGCCATTATTGGGTGAATCATGAACACCACCACATTGGTGGAAGCGATGCAGATGATGTTTGA
AA sequence Show only first row Show all	>Potri.010G190000.2 pacid=42797132 polypeptide=Potri.010G190000.2.p locus=Potri.010G190000 ID=Potri.010G190000.2.v4.1 annot-version=v4.1 MGRLFVESLEGRIYSCKHCRTHLALYDDIVSKSFHCRHGKAYLFKKVVNVFVGEKEERIMITGLHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVL ERFKVSGPDGSHYWVNHEHHHIGGSDADDV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G40110			Yippee family putative zinc-bi...		Potri.010G190000 [exp]	0	1
AT1G51200			A20/AN1-like zinc finger famil...		Potri.006G056500 [exp]	1.00	0.9201
AT3G24010		ATING1	ARABIDOPSIS THALIANA INHIBITOR...		Potri.003G174000 [exp]	1.41	0.8758
AT1G32410			Vacuolar protein sorting 55 (V...		Potri.003G087500 [exp]	2.23	0.8478
AT2G28370			Uncharacterised protein family...		Potri.009G014600 [exp]	3.87	0.8692
AT3G59490			unknown protein		Potri.017G028900 [exp]	5.29	0.8528
AT3G10640		VPS60.1	SNF7 family protein (.1.2)		Potri.010G242700 [exp]	6.78	0.7579
AT1G61150			LisH and RanBPM domains contai...		Potri.011G046200 [exp]	9.53	0.8402
AT5G66050			Wound-responsive family protei...		Potri.005G105900 [exp]	9.53	0.8032
AT5G11440		CID5, IPD1	INCREASED POLYPLOIDY LEVEL IN ...		Potri.006G246600 [exp]	10.95	0.8093
AT3G22750			Protein kinase superfamily pro...		Potri.010G083500 [exp]	11.48	0.7733

Compare expression of checked genes

Potri.010G190000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.