Potri.010G192300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G55820 164 / 4e-51 Fasciclin-like arabinogalactan family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G065101 234 / 1e-79 AT3G55820 98 / 4e-26 Fasciclin-like arabinogalactan family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028268 245 / 4e-83 AT3G55820 142 / 6e-43 Fasciclin-like arabinogalactan family protein (.1)
Lus10040220 179 / 3e-58 AT3G55820 108 / 1e-30 Fasciclin-like arabinogalactan family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02469 Fasciclin Fasciclin domain
Representative CDS sequence
>Potri.010G192300.1 pacid=42797728 polypeptide=Potri.010G192300.1.p locus=Potri.010G192300 ID=Potri.010G192300.1.v4.1 annot-version=v4.1
ATGAGGAGAGGGTGCTTTGTGAAGAACTTAATAGCTTTTGTAGGAGTGGTGATTTCTGTCTGTTGCCTTTTGGTGATTATGGTATCAGTTCTCCAGCTTC
CAGAGGTATCACTCAGAAATGAAGTAACAGGCCCTAACAGAACCATTAGGATCAGGAAGGTTTCCAAGGATGAAGAAATTGGGAGATTTGGTGAGATGAT
GATTGAAATGTTGCCAGAAGATCTTGCTTTTACAGTCTTTGTACCGTCGGAGAAAGCTTTCCAGCGTGATCTGAGGCTACGGCTGAATGATAGTTTGGTA
GCAGAGAAGAGGAATGATACATATGCTGTAGTTTCCCGCATACTGGGCTTCTCAGCTGTTCCTCAAACTCTTTCTTCAGCTACAGTATCCTCTAGTAAAG
AGGTCTTCTATGATTCCTTATCTGGGTTTACGTTGTACATTTCAAAGGATTTAGATGGAATGCTGGTAGTTAATAGAATTCGATCAGAAAAGGTAGACCT
CAGGAGAGGGCAGATTGTTGTACATATTATGGATGGGGTGATCATGGATGCGGAGTTTGAACAGGCAGTTCAACCTGATTACACTGAAGAAGATTGA
AA sequence
>Potri.010G192300.1 pacid=42797728 polypeptide=Potri.010G192300.1.p locus=Potri.010G192300 ID=Potri.010G192300.1.v4.1 annot-version=v4.1
MRRGCFVKNLIAFVGVVISVCCLLVIMVSVLQLPEVSLRNEVTGPNRTIRIRKVSKDEEIGRFGEMMIEMLPEDLAFTVFVPSEKAFQRDLRLRLNDSLV
AEKRNDTYAVVSRILGFSAVPQTLSSATVSSSKEVFYDSLSGFTLYISKDLDGMLVVNRIRSEKVDLRRGQIVVHIMDGVIMDAEFEQAVQPDYTEED

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G55820 Fasciclin-like arabinogalactan... Potri.010G192300 0 1
AT3G52860 unknown protein Potri.014G127900 5.09 0.7051
AT1G60640 unknown protein Potri.004G094500 5.83 0.6402
AT2G27960 CKS1AT, CKS1 cyclin-dependent kinase-subuni... Potri.009G004000 9.48 0.6802
AT5G16790 AtTHO7 Tho complex subunit 7/Mft1p (.... Potri.013G082900 9.79 0.6839
AT2G44820 unknown protein Potri.013G075500 10.39 0.6759
AT5G19350 RNA-binding (RRM/RBD/RNP motif... Potri.009G054400 16.88 0.6892
AT1G51510 Y14 RNA-binding (RRM/RBD/RNP motif... Potri.001G255600 17.74 0.6599
AT5G20180 Ribosomal protein L36 (.1.2) Potri.018G131000 20.97 0.6097
AT1G76860 Small nuclear ribonucleoprotei... Potri.002G068800 39.94 0.6676
AT2G47920 Kinase interacting (KIP1-like)... Potri.002G207700 40.39 0.6665

Potri.010G192300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.