Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05960 150 / 2e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G53980 148 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G37870 97 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48485 42 / 1e-05 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 36 / 0.0009 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G061800 [exp] 216 / 2e-74 AT5G05960 155 / 3e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G104300 [exp] 143 / 2e-45 AT3G53980 143 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G141000 [exp] 104 / 6e-30 AT2G37870 121 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G100600 [exp] 96 / 7e-27 AT2G37870 122 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G149900 [exp] 37 / 0.0008 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009872 [exp] 182 / 1e-60 AT5G05960 148 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004677 [exp] 175 / 5e-58 AT5G05960 142 / 8e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10000397 [exp] 172 / 1e-56 AT5G05960 138 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10031925 [exp] 82 / 2e-20 AT2G37870 133 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10040249 [exp] 64 / 2e-14 AT3G53980 42 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10011358 [exp] 43 / 1e-05 AT1G27950 103 / 5e-28 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10006413 [exp] 43 / 1e-05 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.010G196300.1 pacid=42797882 polypeptide=Potri.010G196300.1.p locus=Potri.010G196300 ID=Potri.010G196300.1.v4.1 annot-version=v4.1 ATGGCAACTCCAATGAAGAACATTTGCTTTGTTATGTTTCTTGCAACTCTCAGCATTGCTTTGTTCAATCAAGTTGACGGGGCTGGTGAATGTGGGAAAA CCACTACTCCTGACAAAGAGGCATTCAAGCTGGCTCCTTGTGCATCAGCAGCACAGGATGAGAATGCTTCAGTTTCTAGCCAATGTTGCGCCAAGGTTAA GAAAATTGAACAGAATCCAGCCTGCCTATGCGCTGTTATGCTTTCGAACACAGCTAAGAGCTCTGGAATCGACCCAGAAATTGCAATGACAATTCCCAAA CGTTGCAACATTGCTGATCGTCCTGTGGGCTACAAGTGTGGAGCTTACACTTTACCCTGA
AA sequence Show only first row Show all	>Potri.010G196300.1 pacid=42797882 polypeptide=Potri.010G196300.1.p locus=Potri.010G196300 ID=Potri.010G196300.1.v4.1 annot-version=v4.1 MATPMKNICFVMFLATLSIALFNQVDGAGECGKTTTPDKEAFKLAPCASAAQDENASVSSQCCAKVKKIEQNPACLCAVMLSNTAKSSGIDPEIAMTIPK RCNIADRPVGYKCGAYTLP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G05960			Bifunctional inhibitor/lipid-t...		Potri.010G196300 [exp]	0	1
					Potri.001G306932 [exp]	2.44	0.9283
AT5G50770		ATHSD6	hydroxysteroid dehydrogenase 6...		Potri.015G100102 [exp]	2.82	0.9303
AT2G15220			Plant basic secretory protein ...		Potri.001G299500 [exp]	4.58	0.8847
AT3G60130		BGLU16	beta glucosidase 16 (.1.2.3)		Potri.001G226200 [exp]	5.47	0.9101	Pt-PLIN-GEN.19
AT5G24090		ATCHIA	chitinase A (.1)		Potri.014G092932 [exp]	5.47	0.8705
AT5G57090		MM31, ATPIN2, A...	WAVY ROOTS 6, ETHYLENE INSENSI...		Potri.001G205200 [exp]	6.00	0.8878	Pt-PIN2.1,PIN10
					Potri.010G169350 [exp]	8.66	0.8130
AT3G21550		AtDMP2	Arabidopsis thaliana DUF679 do...		Potri.008G115100 [exp]	8.77	0.8533
AT2G31335			unknown protein		Potri.019G012400 [exp]	10.39	0.8749
AT4G17220		ATMAP70-5	microtubule-associated protein...		Potri.016G006900 [exp]	11.48	0.8498

Compare expression of checked genes

Potri.010G196300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.