Potri.010G198100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.010G198100.1 pacid=42799755 polypeptide=Potri.010G198100.1.p locus=Potri.010G198100 ID=Potri.010G198100.1.v4.1 annot-version=v4.1
ATGGCTTCTTCAAGTCATCGCCAAAGGCAACTGTCACTCATCACTCCTCGTGATAATCACTCTCATGGCTGCATAACCCAGAAGATGAAAACCTCAACTT
CCATAGAGGATTCAAAGAAAAAGGTGACCATAACCACCGAGACGACGCACAAGCACCGGCCTATATCAAAGGGAAATCGTATTGCCCTTGAACAAGTAGT
CGTCAACCAAAAAAAGAAGACTACCATCGACAAACAGAGGCTAGTCGTTAGGGAGGAGAAGCATGAGGTCAGAGAAAAGAAGATCGTGAGCTCCTACACT
ACAGTAGAGAAGGAGAAGAAGCGAATCCCGCACAAGCATAGAAGCGGTGGCACTTTAGAAGTCACCTTCAAAACAAAATTTTGA
AA sequence
>Potri.010G198100.1 pacid=42799755 polypeptide=Potri.010G198100.1.p locus=Potri.010G198100 ID=Potri.010G198100.1.v4.1 annot-version=v4.1
MASSSHRQRQLSLITPRDNHSHGCITQKMKTSTSIEDSKKKVTITTETTHKHRPISKGNRIALEQVVVNQKKKTTIDKQRLVVREEKHEVREKKIVSSYT
TVEKEKKRIPHKHRSGGTLEVTFKTKF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G198100 0 1
AT5G45290 RING/U-box superfamily protein... Potri.014G053500 2.00 0.7947
AT5G44210 AP2_ERF AtERF9, ATERF-9 ERF DOMAIN PROTEIN- 9, erf dom... Potri.017G013700 3.87 0.7299 ERF46
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Potri.002G216800 5.47 0.7446 Pt-RPM1.1
AT5G57580 Calmodulin-binding protein (.1... Potri.005G020200 5.65 0.7368 CBP60.7
AT5G40760 G6PD6 glucose-6-phosphate dehydrogen... Potri.001G337400 6.00 0.6967 ACG12.1
AT3G17380 TRAF-like family protein (.1) Potri.014G055400 17.32 0.6845
AT5G23350 GRAM domain-containing protein... Potri.004G068200 18.46 0.6949
AT5G23370 GRAM domain-containing protein... Potri.004G068100 20.97 0.6984
Potri.017G077100 22.13 0.7127
AT5G42050 DCD (Development and Cell Deat... Potri.003G141900 22.44 0.7134

Potri.010G198100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.