Potri.010G200000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44920 256 / 4e-87 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G12250 51 / 8e-08 Pentapeptide repeat-containing protein (.1.2)
AT5G55000 43 / 9e-05 FIP2 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G058800 313 / 1e-109 AT2G44920 253 / 1e-85 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.003G112900 51 / 2e-07 AT1G12250 363 / 1e-128 Pentapeptide repeat-containing protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000520 278 / 1e-95 AT2G44920 286 / 6e-99 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10002712 276 / 4e-95 AT2G44920 287 / 3e-99 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10032239 50 / 3e-07 AT1G12250 357 / 9e-125 Pentapeptide repeat-containing protein (.1.2)
Lus10024602 49 / 6e-07 AT1G12250 354 / 1e-123 Pentapeptide repeat-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0505 Pentapeptide PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Representative CDS sequence
>Potri.010G200000.5 pacid=42799922 polypeptide=Potri.010G200000.5.p locus=Potri.010G200000 ID=Potri.010G200000.5.v4.1 annot-version=v4.1
ATGGCTCATCTTCTTAACGTTTCTTTGTGCACCAAAATCCCACCAAAACCCCCTCTCTCACTAACCAAACCTTCCCTCTCAATCCCACGCTTCCTTTCCC
TCTCCCACTCTCGCTGTCCCAACCCACAGGCATTGATACTAAACAAGCAACTGCTAGAAGATTTTGCAAAGACAGGCTTGCTTGCTCTTCTCTCTGTCTC
TCTCTTTTTTACTGATCCTGCTCTTGCATTCAAGGGAGGAGGACCGTATGGTTCTGAAGTTACGAGGGGCCAGGATCTTACTGGCAAGGATTTCAGTGGC
AGAACTTTGATCAAGCAAGATTTTAAGACATCCATACTAAGACAAGCCAATTTCAAAGGTGCAAAGTTGTTGGGAGCTAGCTTTTTCGATGCTGATTTAA
CAGGGGCTGATCTTTCAGATGCTGACCTTAGAAGTGCGGATCTCTCTTTGGCGAATGTGGCAAAGGTAAATTTGAGCAATGCTAACTTGGAAGGCGCGCT
TGCTACTGGCAACACATCTTTTAGAGGATCAAATATAACAGGAGCTGATTTCACAGATGTGCCTTTGAGAGAGGACCAACGTGAGTACTTGTGCAAAGTT
GCCGATGGGGTGAATCCAACTACTGGAAATGCAACACGCGATACATTGCTTTGCAACTAG
AA sequence
>Potri.010G200000.5 pacid=42799922 polypeptide=Potri.010G200000.5.p locus=Potri.010G200000 ID=Potri.010G200000.5.v4.1 annot-version=v4.1
MAHLLNVSLCTKIPPKPPLSLTKPSLSIPRFLSLSHSRCPNPQALILNKQLLEDFAKTGLLALLSVSLFFTDPALAFKGGGPYGSEVTRGQDLTGKDFSG
RTLIKQDFKTSILRQANFKGAKLLGASFFDADLTGADLSDADLRSADLSLANVAKVNLSNANLEGALATGNTSFRGSNITGADFTDVPLREDQREYLCKV
ADGVNPTTGNATRDTLLCN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G44920 Tetratricopeptide repeat (TPR)... Potri.010G200000 0 1
AT4G01050 TROL thylakoid rhodanese-like (.1) Potri.014G096500 1.00 0.9634
AT5G15140 Galactose mutarotase-like supe... Potri.017G080000 2.00 0.9578
AT1G02910 LPA1 LOW PSII ACCUMULATION1, tetrat... Potri.002G206300 2.23 0.9439
AT4G37925 NdhM, NDH-M NADH dehydrogenase-like comple... Potri.002G077600 2.44 0.9522
AT3G09150 ATHY2, GUN3, HY... GENOMES UNCOUPLED 3, ARABIDOPS... Potri.001G253700 2.64 0.9352
AT5G45040 CYTC6A cytochrome c6A, Cytochrome c (... Potri.015G121101 3.87 0.9251
AT1G17650 GR2, GLYR2 glyoxylate reductase 2 (.1) Potri.003G036600 6.92 0.9143
AT4G00730 HD AHDP, ANL2 ANTHOCYANINLESS 2, ARABIDOPSIS... Potri.002G154700 8.36 0.9302 Pt-ANL2.1
AT4G19830 FKBP-like peptidyl-prolyl cis-... Potri.012G119800 9.16 0.9175
AT5G03940 SRP54CP, CPSRP5... SIGNAL RECOGNITION PARTICLE 54... Potri.016G078600 9.79 0.9400

Potri.010G200000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.