Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55520 219 / 2e-73 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G48570 97 / 2e-23 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G25230 88 / 2e-20 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT4G25340 76 / 2e-16 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT5G48580 70 / 3e-15 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT3G25220 68 / 1e-14 FKBP15-1 FK506-binding protein 15 kD-1 (.1) AT5G64350 66 / 5e-14 FKP12, ATFKBP12, FKBP12 ARABIDOPSIS THALIANA FK506-BINDING PROTEIN 12, FK506-binding protein 12 (.1) AT5G05420 66 / 6e-14 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G54010 63 / 8e-12 DEI1, PAS1 PASTICCINO 1, FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1.2) AT3G12340 56 / 4e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G057900 [exp] 246 / 3e-84 AT3G55520 236 / 7e-80 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.014G149400 [exp] 95 / 9e-23 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G248300 [exp] 94 / 2e-22 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.006G033400 [exp] 86 / 7e-20 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 72 / 8e-15 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.012G129200 [exp] 72 / 9e-15 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.002G248200 [exp] 68 / 1e-14 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1) Potri.007G113100 [exp] 66 / 2e-14 AT5G64350 201 / 1e-68 ARABIDOPSIS THALIANA FK506-BINDING PROTEIN 12, FK506-binding protein 12 (.1) Potri.016G105100 [exp] 69 / 7e-14 AT3G54010 825 / 0.0 PASTICCINO 1, FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004714 [exp] 226 / 3e-76 AT3G55520 265 / 3e-91 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10040280 [exp] 226 / 5e-76 AT3G55520 263 / 1e-90 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10002338 [exp] 94 / 3e-22 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10003171 [exp] 93 / 7e-22 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10038216 [exp] 92 / 1e-21 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 92 / 1e-21 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10015029 [exp] 84 / 5e-19 AT4G25340 331 / 8e-110 FK506 BINDING PROTEIN 53 (.1.2) Lus10031700 [exp] 79 / 4e-17 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2) Lus10031121 [exp] 78 / 5e-17 AT4G25340 335 / 3e-110 FK506 BINDING PROTEIN 53 (.1.2) Lus10003170 [exp] 74 / 1e-16 AT3G25220 226 / 4e-77 FK506-binding protein 15 kD-1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00254 [poplar] [flax] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Potri.010G201600.1 pacid=42798594 polypeptide=Potri.010G201600.1.p locus=Potri.010G201600 ID=Potri.010G201600.1.v4.1 annot-version=v4.1 ATGAGTGATTCAATTGATTTATCCGGTGATGGAGGTGTTGTCAAGACAATCTTGAGGAAAGCGAAAGCTGATGCGCTTTGTCCTTCGGATGATCTTCCTC TTGTTGATGTTCAATACGAGGGCACACTTGCTGAAACCGGTGAAGTTTTTGATACGACACGCATGGATAATACTGTGTTCTCATTTGAACTTGGGAAGGG CTCGGTGATTCAGGCATGGGAGATTGCAGTGAAAACCATGAAGGTTGGGGAGGTTGCAAAAATTACTTGCAAACCAGAATTTGCTTATGGCAGTGCAGGT TCCCCGCCAGATATCCCACCTGACGCAACTCTTATTTTTGAGGTGGAGTTGGTGGCCTGCAAGCCACGGAAGGGTTCCAGTGTGACCAGTGTTTCAGAAG AGAGGGCCAGGCTCGAGGAGCTGAAGAAGCAGAGGGAGCTTGCTGCAGCAGCTAAAGAGGAAGAGAAGAAGAGGAGAGAAGAAGCTAAAGCCGCCGCTGC CGCCAGAATACAAGCCAAGCTGGAATCGAAGAAAGGTCAAGGGAAGGGGAAGGGAAAGGCAAAATAG
AA sequence Show only first row Show all	>Potri.010G201600.1 pacid=42798594 polypeptide=Potri.010G201600.1.p locus=Potri.010G201600 ID=Potri.010G201600.1.v4.1 annot-version=v4.1 MSDSIDLSGDGGVVKTILRKAKADALCPSDDLPLVDVQYEGTLAETGEVFDTTRMDNTVFSFELGKGSVIQAWEIAVKTMKVGEVAKITCKPEFAYGSAG SPPDIPPDATLIFEVELVACKPRKGSSVTSVSEERARLEELKKQRELAAAAKEEEKKRREEAKAAAAARIQAKLESKKGQGKGKGKAK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G55520			FKBP-like peptidyl-prolyl cis-...		Potri.010G201600 [exp]	0	1
AT1G69010	bHLH	bHLH102, BIM2	BES1-interacting Myc-like prot...		Potri.004G112900 [exp]	2.00	0.8066
AT1G79200			unknown protein		Potri.005G095700 [exp]	3.74	0.8441
AT4G16530			Family of unknown function (DU...		Potri.001G123200 [exp]	4.24	0.8011
AT4G14385			unknown protein		Potri.002G038700 [exp]	5.19	0.8115
AT5G30495			Fcf2 pre-rRNA processing prote...		Potri.010G002100 [exp]	5.38	0.8521
AT4G22160			unknown protein		Potri.004G004100 [exp]	15.49	0.7915
AT3G27100			unknown protein		Potri.001G330400 [exp]	16.58	0.8050
AT5G37055		ATSWC6, SEF	SERRATED LEAVES AND EARLY FLOW...		Potri.013G152600 [exp]	20.19	0.7580
AT1G21150			Mitochondrial transcription te...		Potri.001G035600 [exp]	21.35	0.7800
AT3G60640		ATG8G	AUTOPHAGY 8G, Ubiquitin-like s...		Potri.002G144600 [exp]	21.44	0.6893

Compare expression of checked genes

Potri.010G201600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.