Potri.010G203900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G55420 253 / 7e-86 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G055800 365 / 7e-130 AT3G55420 254 / 4e-86 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005165 295 / 6e-102 AT3G55420 245 / 2e-82 unknown protein
Lus10023413 274 / 1e-93 AT3G55420 258 / 3e-87 unknown protein
Lus10040295 270 / 6e-92 AT3G55420 249 / 4e-84 unknown protein
PFAM info
Representative CDS sequence
>Potri.010G203900.1 pacid=42798294 polypeptide=Potri.010G203900.1.p locus=Potri.010G203900 ID=Potri.010G203900.1.v4.1 annot-version=v4.1
ATGGAAGAGAAGGAGAAGAAGAAACACAATAAGAAGCAAAAACACCAACACCCAAACCAGCAAACCAGCAAGCCATCATCAGATTTTTCTTTCAAGCCTA
GTTCAGAAGTGAAGGGTCTTCGTTTTGGAGGCCAGTTCATTGTAAAATCCTTCACAATCCGGCGAGCAAGGCCTCTTGAGCTGCTAAAAGTCCTTTCCTA
TCCAGCAACGAACAAGAACAGCAACAACAGTAAGGCCGCTTTCCCTTCAACAACAGCTTTTCTGCCTACAAACTTCACTATATTAGCACACCATGCTTGG
CATACCTTAACACTTGGTCTTGGTACCAAGAAATCCAAAGTACTACTATTTGTCTTTGAATCCGAGTCCATGAAACTGGCTGTTGACAGAATATGGCCAC
CAGAGATACCACTTGGAGAAGTGAACAAGAAACTTATAAGAGGCCTGAATGGATGTGAAATGGCAAGGTTTAAGTTTAGAAAAGGATGCATTACTTTTTA
TGTCTATGCAGTTAGACGTGTAGGCAACCTGGGATTCTCTTGTGCAGATGATTTAAAGATGATATTACAGTCTGTGGTTGCCCTCAATGATTTCTTGGAT
CACACTGCTATGCTTGCCATGCCTCATCAGAGAAGCATCAACTATGCATCACCCCAGGTCGCTATGGCTCACTAG
AA sequence
>Potri.010G203900.1 pacid=42798294 polypeptide=Potri.010G203900.1.p locus=Potri.010G203900 ID=Potri.010G203900.1.v4.1 annot-version=v4.1
MEEKEKKKHNKKQKHQHPNQQTSKPSSDFSFKPSSEVKGLRFGGQFIVKSFTIRRARPLELLKVLSYPATNKNSNNSKAAFPSTTAFLPTNFTILAHHAW
HTLTLGLGTKKSKVLLFVFESESMKLAVDRIWPPEIPLGEVNKKLIRGLNGCEMARFKFRKGCITFYVYAVRRVGNLGFSCADDLKMILQSVVALNDFLD
HTAMLAMPHQRSINYASPQVAMAH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G55420 unknown protein Potri.010G203900 0 1
AT2G47930 AGP26, ATAGP26 ARABIDOPSIS THALIANA ARABINOGA... Potri.002G207500 3.60 0.8599
AT2G35910 RING/U-box superfamily protein... Potri.016G067900 7.74 0.8509
AT5G39420 CDC2CAT CDC2C (.1) Potri.017G088200 8.66 0.8537
AT1G48480 RKL1 receptor-like kinase 1 (.1) Potri.012G044600 10.19 0.8136
AT1G19430 S-adenosyl-L-methionine-depend... Potri.002G260600 12.16 0.8522
AT4G17920 RING/U-box superfamily protein... Potri.001G140900 12.48 0.8543
AT1G30690 Sec14p-like phosphatidylinosit... Potri.001G461400 15.49 0.8420
AT5G20600 unknown protein Potri.012G036500 17.66 0.8339
AT1G28110 SCPL45 serine carboxypeptidase-like 4... Potri.001G065900 17.66 0.8310
AT3G03000 EF hand calcium-binding protei... Potri.003G095700 17.94 0.8174

Potri.010G203900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.