Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17600 91 / 5e-22 RING/U-box superfamily protein (.1) AT2G17450 87 / 1e-21 RHA3A RING-H2 finger A3A (.1) AT2G46493 86 / 3e-21 RING/U-box superfamily protein (.1) AT1G04360 87 / 1e-20 RING/U-box superfamily protein (.1) AT1G20823 83 / 3e-20 RING/U-box superfamily protein (.1) AT3G03550 85 / 8e-20 RING/U-box superfamily protein (.1) AT4G17905 84 / 1e-19 ATL4H RING/U-box superfamily protein (.1) AT5G10380 83 / 2e-19 ATRING1, RING1 RING/U-box superfamily protein (.1) AT4G09120 83 / 3e-19 RING/U-box superfamily protein (.1) AT5G47610 79 / 6e-19 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G054200 [exp] 200 / 2e-66 AT1G20823 80 / 6e-19 RING/U-box superfamily protein (.1) Potri.006G144200 [exp] 105 / 5e-29 AT5G17600 90 / 3e-21 RING/U-box superfamily protein (.1) Potri.013G073500 [exp] 91 / 3e-22 AT3G03550 262 / 2e-85 RING/U-box superfamily protein (.1) Potri.002G101800 [exp] 90 / 1e-21 AT1G72220 195 / 3e-58 RING/U-box superfamily protein (.1) Potri.019G043900 [exp] 87 / 3e-21 AT3G03550 223 / 3e-71 RING/U-box superfamily protein (.1) Potri.001G141200 [exp] 88 / 7e-21 AT5G17600 207 / 1e-63 RING/U-box superfamily protein (.1) Potri.003G093100 [exp] 88 / 7e-21 AT5G17600 196 / 1e-59 RING/U-box superfamily protein (.1) Potri.007G111900 [exp] 88 / 8e-21 AT4G33565 163 / 1e-46 RING/U-box superfamily protein (.1) Potri.005G099000 [exp] 84 / 2e-20 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005954 [exp] 199 / 2e-63 AT3G04020 111 / 7e-28 unknown protein Lus10029456 [exp] 148 / 1e-46 AT5G10380 86 / 3e-21 RING/U-box superfamily protein (.1) Lus10025338 [exp] 92 / 9e-24 AT4G17905 99 / 4e-25 RING/U-box superfamily protein (.1) Lus10024405 [exp] 89 / 1e-22 AT4G17905 95 / 9e-24 RING/U-box superfamily protein (.1) Lus10015167 [exp] 89 / 2e-21 AT3G05200 226 / 2e-71 RING/U-box superfamily protein (.1) Lus10031515 [exp] 88 / 4e-21 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1) Lus10006493 [exp] 88 / 4e-21 AT3G16720 221 / 5e-71 TOXICOS EN LEVADURA 2 (.1) Lus10015901 [exp] 86 / 2e-20 AT1G72220 175 / 3e-51 RING/U-box superfamily protein (.1) Lus10013618 [exp] 86 / 2e-20 AT5G17600 220 / 1e-69 RING/U-box superfamily protein (.1) Lus10012745 [exp] 85 / 6e-20 AT4G33565 168 / 4e-49 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.010G206200.2 pacid=42798653 polypeptide=Potri.010G206200.2.p locus=Potri.010G206200 ID=Potri.010G206200.2.v4.1 annot-version=v4.1 ATGTCAAAACAAGGTGATGATATTAACTCTAAAATTGCCGTTCTTCTGATTGGCGTTGGGTCTGCAGCTCTTGTTATCGCACTCTACCATTGTATTGCCA TGCGCCGGTTCAGGGCTACGACTACTCAGCAACGGCCACGACGATATGGGATAGAAACCATGGCAACGCAAAGCAGTATTGAGAATTCCACGGCCCAACT CATCCCAGCCTATAAGTTCCAAAAGGGTATGGGCTTGGTGGGTGATGATGGAACTTGTGCAATTTGCTTGAGTGAATTTGAAGAAGGTGAGGAACTGCGA ACTTTGCCAGAGTGTTTGCACTCTTACCATGTCGAATGCATTGATATGTGGCTCCATTCGCATACCAATTGTCCCATGTGTCGCACCGATACCACACCTT CTCCAGGGGTCTATTTGAGTGCAAGAGATTTGGATTCTGAGAGGCCATCAGTGGTGTATCAAAATATAGATAGGCTACAAGATATTATTGTACATTCACG GGCACTCTAA
AA sequence Show only first row Show all	>Potri.010G206200.2 pacid=42798653 polypeptide=Potri.010G206200.2.p locus=Potri.010G206200 ID=Potri.010G206200.2.v4.1 annot-version=v4.1 MSKQGDDINSKIAVLLIGVGSAALVIALYHCIAMRRFRATTTQQRPRRYGIETMATQSSIENSTAQLIPAYKFQKGMGLVGDDGTCAICLSEFEEGEELR TLPECLHSYHVECIDMWLHSHTNCPMCRTDTTPSPGVYLSARDLDSERPSVVYQNIDRLQDIIVHSRAL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G17600			RING/U-box superfamily protein...		Potri.010G206200 [exp]	0	1
AT1G12430		AtKINUa, ARK3, ...	phosphatidic acid kinase, Arab...		Potri.003G117000 [exp]	1.00	0.8656	Pt-PAK.1
AT4G17220		ATMAP70-5	microtubule-associated protein...		Potri.006G018000 [exp]	7.93	0.8335
AT3G04090		SIP1A, SIP1;1	small and basic intrinsic prot...		Potri.013G053400 [exp]	8.94	0.7776	SIP1.3
AT3G21510		ATHP3, AHP1	histidine-containing phosphotr...		Potri.008G197600 [exp]	11.22	0.7552	Pt-HPT2.5
AT1G77280			Protein kinase protein with ad...		Potri.002G077900 [exp]	12.40	0.7720
AT1G13340			Regulator of Vps4 activity in ...		Potri.010G127000 [exp]	13.41	0.8086
AT5G20260			Exostosin family protein (.1)		Potri.018G124945 [exp]	15.42	0.7990
AT4G17220		ATMAP70-5	microtubule-associated protein...		Potri.016G006900 [exp]	17.20	0.7969
AT1G11190		ENDO1, BFN1	ENDONUCLEASE 1, bifunctional n...		Potri.011G044500 [exp]	17.49	0.7930	BFN1.1
AT3G07490		AtCML3, AGD11	calmodulin-like 3, ARF-GAP dom...		Potri.006G065900 [exp]	23.91	0.6600	Pt-CBP1.3

Compare expression of checked genes

Potri.010G206200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.