Plant FIBer expression Database

Potri.010G206700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G237700
[exp]
35 / 0.0007 AT5G59305 56 / 5e-12 unknown protein
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.010G206700.1 pacid=42800063 polypeptide=Potri.010G206700.1.p locus=Potri.010G206700 ID=Potri.010G206700.1.v4.1 annot-version=v4.1
ATGAAGAGAAAGCAGATTCTAGCATATGCTCTCCTTGCATTCCTCATAGCTTCTGATCAGTGTCATTACTCTGCAGGAATCGTGGTTCAAGCTGCAAAAT
CAGTTGATACCAGGCTAAAAAATGCACAACCAATATTGAGGTCCACCAGATATAAACTAGCTTCTTGGAAATCCGGAACCAAGTTCAAAGACACTATTCA
CAAGGCTCCATCAGGCCCCAGCCCGATCGGAAATCGGCACAGATCTTCTATCCATGTCTGA
AA sequence
>Potri.010G206700.1 pacid=42800063 polypeptide=Potri.010G206700.1.p locus=Potri.010G206700 ID=Potri.010G206700.1.v4.1 annot-version=v4.1
MKRKQILAYALLAFLIASDQCHYSAGIVVQAAKSVDTRLKNAQPILRSTRYKLASWKSGTKFKDTIHKAPSGPSPIGNRHRSSIHV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G206700
[exp]
0 1
AT4G33910 2-oxoglutarate (2OG) and Fe(II... Potri.007G052600
[exp]
1.00 0.9232
AT1G54690 HTA3 ,G-H2AX ,G... histone H2A 3, GAMMA H2AX, gam... Potri.013G028900
[exp]
11.66 0.8220
AT3G59540 Ribosomal L38e protein family ... Potri.010G181200
[exp]
20.19 0.8554 Pt-RPL38.2
AT4G31985 Ribosomal protein L39 family p... Potri.018G112301
[exp]
26.60 0.8544
AT5G67200 Leucine-rich repeat protein ki... Potri.005G141200
[exp]
28.72 0.8326
AT5G59305 unknown protein Potri.001G237700
[exp]
31.62 0.8280
AT1G26880 Ribosomal protein L34e superfa... Potri.004G029400
[exp]
37.88 0.8512
AT1G46480 HD WOX4 WUSCHEL related homeobox 4 (.1... Potri.014G025300
[exp]
40.62 0.8518
AT5G64140 RPS28 ribosomal protein S28 (.1) Potri.008G013200
[exp]
50.01 0.8442 RPS28.2
AT5G56670 Ribosomal protein S30 family p... Potri.012G086600
[exp]
50.19 0.8316 RPS30.2

Potri.010G206700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.