Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46460 263 / 3e-91 UBC13 ubiquitin-conjugating enzyme 13 (.1) AT5G59300 261 / 4e-90 ATUBC7, UBC7 ARABIDOPSIS THALIANA UBIQUITIN CARRIER PROTEIN 7, ubiquitin carrier protein 7 (.1) AT3G55380 258 / 1e-89 UBC14 ubiquitin-conjugating enzyme 14 (.1.2) AT5G62540 102 / 3e-28 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT2G02760 100 / 2e-27 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 100 / 2e-27 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT3G08690 88 / 1e-22 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT1G64230 87 / 5e-22 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT4G27960 86 / 9e-22 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT3G08700 85 / 2e-21 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G053800 [exp] 286 / 3e-100 AT5G59300 264 / 4e-91 ARABIDOPSIS THALIANA UBIQUITIN CARRIER PROTEIN 7, ubiquitin carrier protein 7 (.1) Potri.010G206766 [exp] 279 / 9e-98 AT3G46460 261 / 2e-90 ubiquitin-conjugating enzyme 13 (.1) Potri.008G053900 [exp] 275 / 6e-96 AT3G55380 287 / 7e-101 ubiquitin-conjugating enzyme 14 (.1.2) Potri.013G064400 [exp] 102 / 2e-28 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.019G039200 [exp] 100 / 2e-27 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.015G064000 [exp] 100 / 2e-27 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.015G023300 [exp] 90 / 2e-23 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.012G033000 [exp] 90 / 2e-23 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.001G094900 [exp] 89 / 4e-23 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040844 [exp] 261 / 1e-90 AT5G59300 290 / 1e-101 ARABIDOPSIS THALIANA UBIQUITIN CARRIER PROTEIN 7, ubiquitin carrier protein 7 (.1) Lus10016573 [exp] 261 / 1e-90 AT5G59300 291 / 6e-102 ARABIDOPSIS THALIANA UBIQUITIN CARRIER PROTEIN 7, ubiquitin carrier protein 7 (.1) Lus10036727 [exp] 103 / 2e-28 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10037203 [exp] 103 / 2e-28 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 101 / 9e-28 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10013263 [exp] 100 / 3e-27 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10033937 [exp] 90 / 3e-23 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10039323 [exp] 90 / 4e-23 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 90 / 4e-23 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 89 / 4e-23 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.010G206832.1 pacid=42799647 polypeptide=Potri.010G206832.1.p locus=Potri.010G206832 ID=Potri.010G206832.1.v4.1 annot-version=v4.1 ATGGCCGCTTCTCAAGCTAGTCTTCTCCTGCAAAAGCAGCTGAGAGATCTATGCAAGAACCCAGTTGATGGATTCTCTGCTGGTTTGATTGATGAAACCA ACGTGTTTGAATGGAGCGTTACAATTATAGGCCCCCCCGATACCTTATATGAAGGGGGTTTCTTCAATGCCATCATGAGCTTTCCACAGAATTATCCAGT CAGTCCTCCAACTGTCAGGTTTACCTCGGAGGTGTGGCATCCAAATGTTTACCCTGATGGAAAAGTTTGCATATCAATTCTTCATCCACCTGGTGACGAC CCAAATGGCTATGAGCTTGCAACTGAGCGCTGGAGTCCAGTTCATACAGTTGAAAGCATTGTTTTGAGCATCATATCAATGCTTTCTAGTCCTAATGACG AGTCTCCTGCAAATGTCGATGCTGCGAAACAATGGAGAGAGAATAGGGACGAGTTCAAGAAGAAAGTAAGCCGATGCGTGAGGAAGTCGCAAGAAATGAT GTAA
AA sequence Show only first row Show all	>Potri.010G206832.1 pacid=42799647 polypeptide=Potri.010G206832.1.p locus=Potri.010G206832 ID=Potri.010G206832.1.v4.1 annot-version=v4.1 MAASQASLLLQKQLRDLCKNPVDGFSAGLIDETNVFEWSVTIIGPPDTLYEGGFFNAIMSFPQNYPVSPPTVRFTSEVWHPNVYPDGKVCISILHPPGDD PNGYELATERWSPVHTVESIVLSIISMLSSPNDESPANVDAAKQWRENRDEFKKKVSRCVRKSQEMM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G46460		UBC13	ubiquitin-conjugating enzyme 1...		Potri.010G206832 [exp]	0	1
AT4G32150		ATVAMP711, VAMP...	vesicle-associated membrane pr...		Potri.006G256200 [exp]	1.00	0.8747
AT2G27730			copper ion binding (.1)		Potri.004G201700 [exp]	1.73	0.8639
AT1G35780			unknown protein		Potri.002G095300 [exp]	2.23	0.8411
AT2G35140			DCD (Development and Cell Deat...		Potri.015G122300 [exp]	3.46	0.8449
AT1G66070			Translation initiation factor ...		Potri.004G082200 [exp]	5.47	0.8681
AT2G47580		U1A	spliceosomal protein U1A (.1)		Potri.002G203600 [exp]	6.63	0.8041
AT5G14140	C2H2ZnF		zinc ion binding;nucleic acid ...		Potri.001G329300 [exp]	7.21	0.7999
AT1G56440		TPR5	tetratricopeptide repeat 5, Te...		Potri.013G008400 [exp]	13.67	0.7946
AT4G29520			unknown protein		Potri.018G067300 [exp]	13.74	0.8263
AT5G58110			chaperone binding;ATPase activ...		Potri.006G080900 [exp]	19.28	0.8291

Compare expression of checked genes

Potri.010G206832 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.