Plant FIBer expression Database

Potri.010G207100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12587 66 / 3e-17 Oligosaccaryltransferase (.1)
AT5G02502 65 / 1e-16 Oligosaccaryltransferase (.1)
AT3G09470 44 / 4e-07 Major facilitator superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G053300
[exp]
74 / 1e-20 AT3G12587 64 / 2e-16 Oligosaccaryltransferase (.1)
Potri.008G053200
[exp]
72 / 9e-20 AT3G12587 66 / 3e-17 Oligosaccaryltransferase (.1)
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10215 Ost4 Oligosaccaryltransferase
Representative CDS sequence
>Potri.010G207100.7 pacid=42797314 polypeptide=Potri.010G207100.7.p locus=Potri.010G207100 ID=Potri.010G207100.7.v4.1 annot-version=v4.1
ATGTTTGATGATCAAGATCTGGGTTTTTTTGCCAATTTTCTTGGCATTTTTATATTTGTTCTGGTGATCGCTTACCATTATGTGATGGCTGACCCAAAAT
ATGAAGGCAACTGA
AA sequence
>Potri.010G207100.7 pacid=42797314 polypeptide=Potri.010G207100.7.p locus=Potri.010G207100 ID=Potri.010G207100.7.v4.1 annot-version=v4.1
MFDDQDLGFFANFLGIFIFVLVIAYHYVMADPKYEGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G12587 Oligosaccaryltransferase (.1) Potri.010G207100
[exp]
0 1
AT5G17190 unknown protein Potri.010G108000
[exp]
2.44 0.9084
AT2G17380 AP19 associated protein 19 (.1) Potri.012G052000
[exp]
3.00 0.9050 AP19.2
AT5G50460 secE/sec61-gamma protein trans... Potri.001G329400
[exp]
9.16 0.9083
AT2G25310 Protein of unknown function (D... Potri.006G257100
[exp]
12.00 0.9023
AT1G74340 DPMS2, DPMS dolichol phosphate mannose syn... Potri.001G138100
[exp]
19.44 0.8842
AT2G45530 RING/U-box superfamily protein... Potri.011G149200
[exp]
21.33 0.8947
AT1G47830 SNARE-like superfamily protein... Potri.002G022900
[exp]
22.91 0.8981
AT1G21930 unknown protein Potri.002G086300
[exp]
24.37 0.8577
AT5G56150 UBC30 ubiquitin-conjugating enzyme 3... Potri.019G083800
[exp]
26.26 0.8929 UBC.5
AT2G19790 SNARE-like superfamily protein... Potri.006G149100
[exp]
28.37 0.8807

Potri.010G207100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.