Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07870 47 / 5e-07 F-box and associated interaction domains-containing protein (.1) AT3G17710 42 / 4e-05 F-box and associated interaction domains-containing protein (.1) AT3G17480 40 / 0.0003 F-box and associated interaction domains-containing protein (.1) AT1G70380 39 / 0.0005 F-box and associated interaction domains-containing protein (.1) AT1G50870 39 / 0.0006 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G207500 [exp] 108 / 7e-29 AT4G12560 94 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.008G006900 [exp] 93 / 4e-23 AT4G12560 95 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.008G006800 [exp] 86 / 2e-20 AT4G12560 100 / 4e-23 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.011G121200 [exp] 76 / 6e-17 AT4G12560 116 / 9e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.003G145950 [exp] 61 / 8e-12 AT4G12560 113 / 7e-28 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G318400 [exp] 56 / 8e-10 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.001G224200 [exp] 50 / 1e-07 AT3G07870 105 / 4e-25 F-box and associated interaction domains-containing protein (.1) Potri.008G216000 [exp] 49 / 2e-07 AT1G47340 65 / 9e-12 F-box and associated interaction domains-containing protein (.1) Potri.008G215800 [exp] 48 / 3e-07 AT3G07870 101 / 3e-23 F-box and associated interaction domains-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026587 [exp] 66 / 2e-13 AT3G06240 104 / 3e-24 F-box family protein (.1) Lus10013873 [exp] 66 / 3e-13 AT3G06240 104 / 2e-24 F-box family protein (.1) Lus10013872 [exp] 65 / 6e-13 AT3G06240 101 / 2e-23 F-box family protein (.1) Lus10038603 [exp] 62 / 7e-12 AT3G06240 110 / 2e-26 F-box family protein (.1) Lus10031020 [exp] 62 / 8e-12 AT3G10430 88 / 3e-19 F-box and associated interaction domains-containing protein (.1) Lus10039593 [exp] 59 / 2e-11 AT4G12560 75 / 9e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10029527 [exp] 60 / 3e-11 AT3G07870 70 / 6e-13 F-box and associated interaction domains-containing protein (.1) Lus10038606 [exp] 59 / 8e-11 AT3G07870 112 / 1e-27 F-box and associated interaction domains-containing protein (.1) Lus10037892 [exp] 55 / 1e-09 AT3G06240 107 / 7e-26 F-box family protein (.1) Lus10023239 [exp] 45 / 3e-06 AT3G23880 130 / 3e-34 F-box and associated interaction domains-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [poplar] [flax] F-box PF00646 [poplar] [flax] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Potri.010G207401.1 pacid=42796904 polypeptide=Potri.010G207401.1.p locus=Potri.010G207401 ID=Potri.010G207401.1.v4.1 annot-version=v4.1 ATGGCTGAAAGTGTGAAAAAGAATCGTGTTCCAGAAGATGTGTTGATAGATATTCTCACAGCATTACCTATCAAATCCTTATTAAGATTCAGATCTTTAT CAAAATCATGGAACTCCCACATCAGTGACAAAGACTTCATCAGTGCCTATTTGGCCCAACCCAAACCATCGCTTCTCCTTCGTCGATGGCAAAATCGTCA AGAATCCTACTCTCTGCATCTCGATAATGAATCTTTAGATAGGAGCTTACAGTTCCAGAACTTGCCCTTTCGGTGTGAAGCTGATTGTTTTGATATAATA GGTTATTGCAATGGAGTTGTATGTCTTTCAGATATTCACCAAGGTCGCACTACGAGTCTTATTCTGTGGAATCCATCAATTAGAAAACATTTGAATCTAG CACTTCCATAG
AA sequence Show only first row Show all	>Potri.010G207401.1 pacid=42796904 polypeptide=Potri.010G207401.1.p locus=Potri.010G207401 ID=Potri.010G207401.1.v4.1 annot-version=v4.1 MAESVKKNRVPEDVLIDILTALPIKSLLRFRSLSKSWNSHISDKDFISAYLAQPKPSLLLRRWQNRQESYSLHLDNESLDRSLQFQNLPFRCEADCFDII GYCNGVVCLSDIHQGRTTSLILWNPSIRKHLNLALP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G07870			F-box and associated interacti...		Potri.010G207401 [exp]	0	1
					Potri.001G383801 [exp]	4.24	0.6653
AT1G76750			Protein of unknown function (D...		Potri.001G306700 [exp]	14.28	0.6382
AT3G17660		AGD15	ARF-GAP domain 15 (.1)		Potri.012G036900 [exp]	15.29	0.5663
					Potri.008G206100 [exp]	21.35	0.6413
					Potri.013G126450 [exp]	22.09	0.6326
AT3G02280			Flavodoxin family protein (.1)		Potri.011G027100 [exp]	22.44	0.6345
					Potri.018G043850 [exp]	29.93	0.6046
					Potri.002G047750 [exp]	30.24	0.6346
					Potri.005G192050 [exp]	35.32	0.6089
AT3G24060			Plant self-incompatibility pro...		Potri.001G053300 [exp]	39.68	0.5933

Compare expression of checked genes

Potri.010G207401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.