Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59890 255 / 4e-89 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2) AT3G46010 253 / 3e-88 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2) AT3G46000 238 / 2e-82 ADF2 actin depolymerizing factor 2 (.1) AT5G59880 236 / 2e-81 ADF3 actin depolymerizing factor 3 (.1.2) AT4G00680 227 / 4e-78 ADF8 actin depolymerizing factor 8 (.1) AT1G01750 227 / 5e-78 ADF11 actin depolymerizing factor 11 (.1) AT4G25590 221 / 2e-75 ADF7 actin depolymerizing factor 7 (.1) AT5G52360 213 / 1e-72 ADF10 actin depolymerizing factor 10 (.1) AT2G31200 184 / 5e-61 ADF6, ATADF6 actin depolymerizing factor 6 (.1) AT2G16700 172 / 2e-56 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G052100 [exp] 268 / 2e-94 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2) Potri.009G028100 [exp] 266 / 2e-93 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2) Potri.009G028200 [exp] 265 / 5e-93 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2) Potri.001G236700 [exp] 265 / 6e-93 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2) Potri.001G236400 [exp] 257 / 6e-90 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2) Potri.015G144500 [exp] 228 / 2e-78 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1) Potri.012G141600 [exp] 227 / 5e-78 AT4G25590 254 / 5e-89 actin depolymerizing factor 7 (.1) Potri.001G106200 [exp] 227 / 7e-78 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1) Potri.003G125500 [exp] 225 / 3e-77 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024418 [exp] 257 / 1e-89 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2) Lus10024417 [exp] 255 / 4e-89 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025319 [exp] 255 / 4e-89 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10023428 [exp] 262 / 1e-88 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2) Lus10040307 [exp] 258 / 5e-88 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2) Lus10027474 [exp] 222 / 5e-76 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1) Lus10038859 [exp] 214 / 4e-73 AT4G25590 232 / 2e-80 actin depolymerizing factor 7 (.1) Lus10014977 [exp] 213 / 9e-73 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1) Lus10039229 [exp] 209 / 5e-71 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1) Lus10022933 [exp] 190 / 4e-63 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0092 [poplar] [flax] ADF PF00241 [poplar] [flax] Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence Show only first row Show all	>Potri.010G208500.2 pacid=42798025 polypeptide=Potri.010G208500.2.p locus=Potri.010G208500 ID=Potri.010G208500.2.v4.1 annot-version=v4.1 ATGGCAAACGCAGCATCTGGGATGGCTGTGCATGATGACTGCAAGCTGAGGTTTTTGGATTTGAAGGCAAAAAGGACTTACCGTTTCATTGTTTTCAAGA TTGAGGAGAAGCAAAAGCAGGTGATTGTGGAGAAGCTTGGTGAACCAGCTGATAGCTATGAAAATTTCTCTGCCAGTCTGCCCGCTGATGAGTGTCGATA TGCTGTTTATGACTTTGATTATGTAACAGAGGAGAACTGCCAGAAGAGCAGGATTGTTTTTATTGCATGGTGCCCTGACACGGCTAGGGTGAGAAGCAAG ATGATTTATGCAAGCTCCAAGGACAGGTTTAAGAGAGAATTAGATGGTATTCAGATTGAGCTGCAAGCTACTGATCCTACAGAGATGGGGCTTGATGTTA TTAGAAGCCGTTCGAATTAA
AA sequence Show only first row Show all	>Potri.010G208500.2 pacid=42798025 polypeptide=Potri.010G208500.2.p locus=Potri.010G208500 ID=Potri.010G208500.2.v4.1 annot-version=v4.1 MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVIVEKLGEPADSYENFSASLPADECRYAVYDFDYVTEENCQKSRIVFIAWCPDTARVRSK MIYASSKDRFKRELDGIQIELQATDPTEMGLDVIRSRSN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.010G208500 [exp]	0	1
AT3G06170			Serinc-domain containing serin...		Potri.008G201900 [exp]	1.00	0.8008
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Potri.003G067100 [exp]	1.41	0.7755
AT2G46800		ATMTP1, ZAT1, Z...	ZINC TRANSPORTER OF ARABIDOPSI...		Potri.001G450900 [exp]	2.82	0.7383
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Potri.004G160300 [exp]	7.93	0.6923	RD19.3
AT2G37410		ATTIM17-2	TRANSLOCASE OF THE INNER MEMBR...		Potri.008G176500 [exp]	11.31	0.7111	TIM17.2
AT1G31812		ACBP6, ACBP	acyl-CoA-binding protein 6 (.1...		Potri.001G130200 [exp]	13.63	0.7172
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.008G052100 [exp]	14.79	0.7693
AT1G51200			A20/AN1-like zinc finger famil...		Potri.016G051700 [exp]	15.42	0.7137
AT1G52280		AtRABG3d	RAB GTPase homolog G3D (.1)		Potri.003G053400 [exp]	15.96	0.7326
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Potri.001G334600 [exp]	20.85	0.6380

Compare expression of checked genes

Potri.010G208500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.