Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64620 93 / 6e-24 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT3G17152 69 / 9e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46930 66 / 1e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46960 59 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G47960 59 / 9e-11 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT5G46970 58 / 1e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17150 57 / 3e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17220 56 / 4e-10 ATPMEI2 pectin methylesterase inhibitor 2 (.1) AT5G46940 55 / 1e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46950 52 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G108301 [exp] 104 / 2e-28 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.009G083500 [exp] 86 / 2e-21 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.010G063000 [exp] 70 / 4e-15 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.006G134900 [exp] 68 / 1e-14 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.007G068300 [exp] 66 / 7e-14 AT4G00872 113 / 4e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086500 [exp] 53 / 1e-08 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.004G016500 [exp] 52 / 1e-08 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G119200 [exp] 51 / 7e-08 AT1G02550 97 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G102600 [exp] 49 / 1e-07 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022409 [exp] 72 / 4e-16 AT5G64620 155 / 3e-48 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10016318 [exp] 65 / 3e-13 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10003530 [exp] 62 / 5e-12 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016317 [exp] 59 / 7e-11 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017077 [exp] 56 / 7e-10 AT3G17152 76 / 1e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10002933 [exp] 56 / 7e-10 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017345 [exp] 55 / 1e-09 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1) Lus10037793 [exp] 56 / 2e-09 AT3G17152 74 / 5e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10016319 [exp] 52 / 2e-08 AT3G17130 151 / 8e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001658 [exp] 50 / 6e-08 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.010G209800.1 pacid=42797804 polypeptide=Potri.010G209800.1.p locus=Potri.010G209800 ID=Potri.010G209800.1.v4.1 annot-version=v4.1 ATGAATTTTCTTGCCTGGCTTCCCCTTTTCCTTCTAGTCAATTTCTTGCATCAACCTACGACGTTGGTAGGGGCTGATCTTATACAAGAAACTTGCCAGA AAACCAGGTACCCTGCTCTTTGCGTGAAAACCCTAAAGTCAAACCCACGAAGCTCTACTGCTGATGCCAAAGGACTTGTTCATATAATGCTAGAAGCTAA CTTGGCAAATAGTAAACTTACTTTGGCCACAGTAAGCAAACTGCTTAAAGAGTCTAGTGATAAAGCCTTGAAGAAATGCCTCGACGTGTGCGCAGAGGAG TACGACACGGCTGCCAATGATGATTTTCCTACTGCAATACAAAGTTTAGAGATAAATGATCTTGGCACAGCAAAAATTCATGTAAGCGCTGCTTTTGATG CTCCAGGGAACTGTAGAGACACATTTTCGGAAGTTCCAGGCGTTCAAGCACCACCTGATTTAAGCAAGCTGAATGATTATTTTGAGCAGCTTTCTGTAAC AGCTCTCATAATGTTAAACAATCTCGGTTGA
AA sequence Show only first row Show all	>Potri.010G209800.1 pacid=42797804 polypeptide=Potri.010G209800.1.p locus=Potri.010G209800 ID=Potri.010G209800.1.v4.1 annot-version=v4.1 MNFLAWLPLFLLVNFLHQPTTLVGADLIQETCQKTRYPALCVKTLKSNPRSSTADAKGLVHIMLEANLANSKLTLATVSKLLKESSDKALKKCLDVCAEE YDTAANDDFPTAIQSLEINDLGTAKIHVSAAFDAPGNCRDTFSEVPGVQAPPDLSKLNDYFEQLSVTALIMLNNLG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Potri.010G209800 [exp]	0	1
AT5G01710			methyltransferases (.1)		Potri.013G153300 [exp]	2.44	0.6696
AT2G27410	B3		Domain of unknown function (DU...		Potri.013G031600 [exp]	14.49	0.5220
					Potri.007G075066 [exp]	15.49	0.5321
					Potri.005G157601 [exp]	23.87	0.5417
AT3G04900			Heavy metal transport/detoxifi...		Potri.009G126600 [exp]	26.00	0.4870
AT1G44414			unknown protein		Potri.002G083100 [exp]	45.29	0.4852
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.004G043600 [exp]	59.39	0.4813
AT4G20310			Peptidase M50 family protein (...		Potri.001G073200 [exp]	68.93	0.4745
AT4G14965		ATMAPR4	membrane-associated progestero...		Potri.006G023801 [exp]	70.93	0.4736
					Potri.019G108100 [exp]	83.90	0.4581

Compare expression of checked genes

Potri.010G209800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.