Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ATRPL23.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55280 195 / 7e-65 RPL23A2, RPL23AB RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) AT2G39460 190 / 6e-63 RPL23A1, RPL23AA, ATRPL23A RIBOSOMAL PROTEIN L23A1, ARABIDOPSIS THALIANA RIBOSOMAL PROTEIN L23A, ribosomal protein L23AA (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G050200 [exp] 229 / 3e-78 AT3G55280 187 / 8e-62 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Potri.009G027000 [exp] 223 / 8e-76 AT3G55280 199 / 2e-66 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Potri.016G079800 [exp] 213 / 6e-72 AT3G55280 187 / 5e-62 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Potri.006G213300 [exp] 211 / 3e-71 AT3G55280 204 / 1e-68 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003290 [exp] 205 / 8e-69 AT3G55280 207 / 8e-70 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Lus10004942 [exp] 204 / 1e-68 AT3G55280 207 / 7e-70 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Lus10005441 [exp] 205 / 2e-68 AT3G55280 208 / 8e-70 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Lus10023438 [exp] 203 / 5e-68 AT3G55280 206 / 4e-69 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Lus10030325 [exp] 202 / 9e-68 AT3G55280 204 / 1e-68 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Lus10040316 [exp] 202 / 2e-67 AT3G55280 202 / 2e-67 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Lus10005883 [exp] 200 / 6e-67 AT3G55280 205 / 7e-69 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Lus10040865 [exp] 204 / 1e-62 AT5G59750 714 / 0.0 DHBP synthase RibB-like alpha/beta domain;GTP cyclohydrolase II (.1.2) Lus10025302 [exp] 90 / 2e-23 AT3G55280 98 / 8e-27 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3) Lus10024430 [exp] 89 / 6e-23 AT3G55280 98 / 8e-27 RIBOSOMAL PROTEIN L23A2, ribosomal protein L23AB (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00276 [poplar] [flax] Ribosomal_L23 Ribosomal protein L23 PF03939 [poplar] [flax] Ribosomal_L23eN Ribosomal protein L23, N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.010G210300.3 pacid=42800288 polypeptide=Potri.010G210300.3.p locus=Potri.010G210300 ID=Potri.010G210300.3.v4.1 annot-version=v4.1 ATGTCTCCGGCTAAAGCTGATGCATCCAGAAAGCCTGATCCAAAGGCACAAGCCCAGAAGGCTGCCAGGGCTGTGAAATCAGGGCCAACATTCAAGAAAA CAAAGAAGATCCGGACAAAGGTTACATTTCACCGTCCCAGGACATTGAAGAAGGAGAGGAATCCCAAGTATCCACGCATCAGTGCAACACCTAGAAATAA GCTGGACCACTATCAGATTCTGAAGTATCCACTTACTACTGAGTCTGCAATGAAAAAGATTGAAGACAACAATACCCTTGTGTTCATTGTTGACATTCGT GCAGACAAGAAGAAAATTAAAGATGCAGTTAAGAAGATGTACGACATTCAGACCAAGAAAGTGAATACTTTGATCAGGCCTGATGGAACTAAGAAGGCAT ACGTCAGGTTGACTCCTGATTATGATGCCTTAGATGTGGCAAACAAGATTGGGATCATATAA
AA sequence Show only first row Show all	>Potri.010G210300.3 pacid=42800288 polypeptide=Potri.010G210300.3.p locus=Potri.010G210300 ID=Potri.010G210300.3.v4.1 annot-version=v4.1 MSPAKADASRKPDPKAQAQKAARAVKSGPTFKKTKKIRTKVTFHRPRTLKKERNPKYPRISATPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIR ADKKKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Potri.010G210300 [exp]	0	1	ATRPL23.2
AT5G07090			Ribosomal protein S4 (RPS4A) f...		Potri.015G033700 [exp]	2.00	0.9016	Pt-RPS4.2
AT4G39200			Ribosomal protein S25 family p...		Potri.010G239300 [exp]	5.65	0.8991
AT2G44120			Ribosomal protein L30/L7 famil...		Potri.006G073200 [exp]	7.41	0.8863
AT4G31985			Ribosomal protein L39 family p...		Potri.006G188500 [exp]	12.24	0.8436
AT2G19740			Ribosomal protein L31e family ...		Potri.009G064100 [exp]	13.22	0.8824
AT3G05560			Ribosomal L22e protein family ...		Potri.002G204100 [exp]	15.23	0.8777	RPL22.4
AT5G61170			Ribosomal protein S19e family ...		Potri.015G056100 [exp]	16.58	0.8468
AT1G74050			Ribosomal protein L6 family pr...		Potri.001G271500 [exp]	16.70	0.8988
AT3G49910			Translation protein SH3-like f...		Potri.007G085200 [exp]	18.30	0.8148	Pt-RPL26.2
AT4G18100			Ribosomal protein L32e (.1)		Potri.014G191000 [exp]	23.32	0.8636

Compare expression of checked genes

Potri.010G210300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.