Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07730 103 / 2e-25 Disease resistance-responsive (dirigent-like protein) family protein (.2) AT2G39430 97 / 1e-23 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G28670 95 / 1e-23 ESB1 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT4G13580 94 / 3e-23 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G24020 93 / 8e-23 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G55230 93 / 2e-22 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21100 49 / 7e-07 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49030 47 / 1e-05 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3) AT3G13650 45 / 1e-05 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 45 / 1e-05 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G049200 [exp] 108 / 6e-28 AT2G28670 276 / 2e-90 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.008G049100 [exp] 105 / 3e-26 AT2G39430 251 / 6e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.010G211800 [exp] 101 / 2e-25 AT2G28670 257 / 6e-83 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.010G211900 [exp] 97 / 2e-23 AT2G39430 249 / 3e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G054000 [exp] 94 / 4e-23 AT3G24020 352 / 5e-124 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G174300 [exp] 93 / 1e-22 AT3G24020 315 / 2e-109 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G054100 [exp] 92 / 4e-22 AT4G13580 308 / 3e-106 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G130900 [exp] 47 / 2e-06 AT2G21110 185 / 5e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 46 / 4e-06 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003301 [exp] 187 / 1e-55 AT3G55230 254 / 2e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10006317 [exp] 100 / 5e-25 AT2G28670 271 / 1e-89 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Lus10011767 [exp] 99 / 1e-24 AT3G24020 339 / 7e-119 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10023689 [exp] 98 / 2e-24 AT3G24020 336 / 1e-117 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029585 [exp] 91 / 5e-23 AT2G28670 166 / 6e-53 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Lus10030318 [exp] 92 / 3e-22 AT3G55230 276 / 2e-93 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034479 [exp] 52 / 4e-08 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025064 [exp] 52 / 6e-08 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025063 [exp] 51 / 2e-07 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025065 [exp] 51 / 2e-07 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF03018 [poplar] [flax] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Potri.010G212000.1 pacid=42797715 polypeptide=Potri.010G212000.1.p locus=Potri.010G212000 ID=Potri.010G212000.1.v4.1 annot-version=v4.1 ATGAAAATGGGTAAGCTTCCTTCCATGCTGAGCTTGGTTTGCTCGCTCCTTTGCATGAATATCATCAACCGATCATCCTTCGCTCGAAGCCTTGGCAATT CAAGTCCTGGCCAACACCACCACCACAACCACCACAAGAAAATAACTTTCCTAATGCAAAATGTGCTGAATGTGACACACCCCTTACCAAAGCCTGCAAC AACTAAAGTTACTAGCCAGATACCATTTCCAAAACCTCTAGGCTATTTTCCTCCGAGTGGAGGCATCCCTTTACAACAACCCAACGCAGCAGTTTCCGGT ACTGGGTTGTCAACACAAACAATTGACGTTTCTAACATTGGCCTATCATTTCCGGATAGAGCTACCTTGCAAGAGTTGGAATTTGGAAGTGTAACAGAAA TTGGCGAGGACTTATTTGTTTATGGTTCATTAGTGGTTGGAAAAGCACAAGGGTTGTACGTTGCTAGCTCAGAAGATGGAACTAGCCACATGATGGCAAT GACAGTAAAGTTTGTGAAGAATAAGTACAAGGATGGGTTGAGATTTTTTGGTGTGCATAAGACAGACGTGCCTGAGTCTCATATTGCAGTCATTGGTGGC ACTGGGAAGTATCATAGTGCCAATGGCTATGCTGTGATCAACGCGGTTGGTGTTGGTTCTAAGAGTACTGCAGGGGAAGAAAACAGAACAAAAGGAAATC TTCTATTCAATGTTTATCTAAGCTAG
AA sequence Show only first row Show all	>Potri.010G212000.1 pacid=42797715 polypeptide=Potri.010G212000.1.p locus=Potri.010G212000 ID=Potri.010G212000.1.v4.1 annot-version=v4.1 MKMGKLPSMLSLVCSLLCMNIINRSSFARSLGNSSPGQHHHHNHHKKITFLMQNVLNVTHPLPKPATTKVTSQIPFPKPLGYFPPSGGIPLQQPNAAVSG TGLSTQTIDVSNIGLSFPDRATLQELEFGSVTEIGEDLFVYGSLVVGKAQGLYVASSEDGTSHMMAMTVKFVKNKYKDGLRFFGVHKTDVPESHIAVIGG TGKYHSANGYAVINAVGVGSKSTAGEENRTKGNLLFNVYLS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07730			Disease resistance-responsive ...		Potri.010G212000 [exp]	0	1
AT4G22790			MATE efflux family protein (.1...		Potri.003G116700 [exp]	2.82	0.8488
AT5G46060			Protein of unknown function, D...		Potri.001G372900 [exp]	45.59	0.8163
AT1G31050	bHLH	bHLH111	basic helix-loop-helix (bHLH) ...		Potri.010G098900 [exp]	50.29	0.8033
AT3G01900		CYP94B2	"cytochrome P450, family 94, s...		Potri.001G331100 [exp]	51.23	0.8241	CYP94.2
AT5G04870		AK1, ATCPK1, CP...	calcium dependent protein kina...		Potri.008G014700 [exp]	119.74	0.7798	Pt-CPK2.2
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Potri.003G008200 [exp]	144.47	0.7668
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.016G022400 [exp]	168.41	0.8028
AT1G06840			Leucine-rich repeat protein ki...		Potri.019G131800 [exp]	195.51	0.7973
AT5G15500			Ankyrin repeat family protein ...		Potri.018G050600 [exp]	219.33	0.7682
AT5G65030			unknown protein		Potri.007G092300 [exp]	228.52	0.7845

Compare expression of checked genes

Potri.010G212000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.