Plant FIBer expression Database

Potri.010G214400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62200 94 / 5e-24 Embryo-specific protein 3, (ATS3) (.1)
AT2G41475 89 / 2e-22 Embryo-specific protein 3, (ATS3) (.1)
AT5G62210 82 / 2e-19 Embryo-specific protein 3, (ATS3) (.1)
AT5G07190 76 / 4e-17 ATS3 seed gene 3 (.1.2)
AT2G22170 47 / 2e-06 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
AT4G39730 44 / 8e-06 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G131800
[exp]
89 / 2e-22 AT2G41475 197 / 5e-65 Embryo-specific protein 3, (ATS3) (.1)
Potri.001G193500
[exp]
88 / 4e-22 AT5G62200 184 / 1e-59 Embryo-specific protein 3, (ATS3) (.1)
Potri.015G132700
[exp]
86 / 5e-21 AT5G62200 204 / 1e-67 Embryo-specific protein 3, (ATS3) (.1)
Potri.006G069800
[exp]
85 / 9e-21 AT2G41475 194 / 1e-63 Embryo-specific protein 3, (ATS3) (.1)
Potri.012G130900
[exp]
80 / 1e-18 AT5G62200 154 / 1e-47 Embryo-specific protein 3, (ATS3) (.1)
Potri.015G132900
[exp]
74 / 2e-16 AT5G62200 153 / 4e-47 Embryo-specific protein 3, (ATS3) (.1)
Potri.012G130800
[exp]
62 / 2e-12 AT5G62200 150 / 6e-47 Embryo-specific protein 3, (ATS3) (.1)
Potri.007G091000
[exp]
46 / 2e-06 AT2G22170 216 / 1e-72 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Potri.005G076900
[exp]
43 / 2e-05 AT2G22170 214 / 6e-72 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027387
[exp]
97 / 2e-25 AT5G62200 225 / 1e-75 Embryo-specific protein 3, (ATS3) (.1)
Lus10031684
[exp]
97 / 3e-25 AT5G62200 223 / 5e-75 Embryo-specific protein 3, (ATS3) (.1)
Lus10019416
[exp]
80 / 9e-19 AT2G41475 179 / 7e-58 Embryo-specific protein 3, (ATS3) (.1)
Lus10043273
[exp]
0 / 1 AT2G41475 107 / 7e-32 Embryo-specific protein 3, (ATS3) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0321 PLAT PF06232 ATS3 Embryo-specific protein 3, (ATS3)
Representative CDS sequence
>Potri.010G214400.1 pacid=42799325 polypeptide=Potri.010G214400.1.p locus=Potri.010G214400 ID=Potri.010G214400.1.v4.1 annot-version=v4.1
ATGAGGAGAACAAGCTCTCCGATCCTTTTCATCGTAGCCATTACAATTTCTTCTCTGGGCATTTTAAACCAAGCCACGAATGTCACCTTCCAAGGATCAT
CATCAAAAAACTGTTCATATTCAATTGAGATTGAAACAACTTGTGCTCCATCTGCTGAAACTAAAGATCACATCAGTGTTAGGTTCAGTGATTCTGCAGG
GAACTTGATCATAGTGAAGCATCTAAAGAACCCCAAGCTGTTATATGCTCCAAAGGGTTTTAAGAAACAAGGTGGTGCGTATGGAGGATTTGAAAGATGT
GCCATAGACTTGTTTGAGGCAAGTGGAACGTGCATGAAGCAAAGTGTGTGCTCATTGTACCTTAAGAAAGTTGGTACTGATGATTGGAGACCAGGATGGG
TCAAGGTGCTTCATCAAGAAAGCAGCGGTGCTTTAGTACCAGTTTCTTATGTGTTCTATTTTAGAACATTTGTGCCTGAAAATGTCTGGTATGGCTTGGA
TTATTGTCATTCTAAAGAAGGTTTTATGCCTCACTTTGCAACCTTCGAAACCTAA
AA sequence
>Potri.010G214400.1 pacid=42799325 polypeptide=Potri.010G214400.1.p locus=Potri.010G214400 ID=Potri.010G214400.1.v4.1 annot-version=v4.1
MRRTSSPILFIVAITISSLGILNQATNVTFQGSSSKNCSYSIEIETTCAPSAETKDHISVRFSDSAGNLIIVKHLKNPKLLYAPKGFKKQGGAYGGFERC
AIDLFEASGTCMKQSVCSLYLKKVGTDDWRPGWVKVLHQESSGALVPVSYVFYFRTFVPENVWYGLDYCHSKEGFMPHFATFET

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G62200 Embryo-specific protein 3, (AT... Potri.010G214400
[exp]
0 1
AT3G18670 Ankyrin repeat family protein ... Potri.005G057900
[exp]
1.00 0.9924
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Potri.001G340400
[exp]
2.82 0.9849
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Potri.001G340200
[exp]
3.00 0.9781
AT5G51160 Ankyrin repeat family protein ... Potri.014G051100
[exp]
3.46 0.9700
AT5G20480 EFR EF-TU receptor (.1) Potri.004G098501
[exp]
3.87 0.9474
AT3G28455 CLE25 CLAVATA3/ESR-RELATED 25 (.1) Potri.017G074600
[exp]
4.24 0.9555 CLE25.1
AT5G50790 SWEET10, AtSWEE... Nodulin MtN3 family protein (.... Potri.015G101500
[exp]
5.19 0.9268
Potri.011G102400
[exp]
5.47 0.9684
Potri.018G104500
[exp]
6.00 0.9526
AT3G62950 Thioredoxin superfamily protei... Potri.002G208500
[exp]
6.48 0.9578

Potri.010G214400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.