Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37250 382 / 2e-134 ADK, ATPADK1 adenosine kinase (.1) AT2G39270 350 / 2e-121 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G01820 142 / 1e-40 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G35170 114 / 3e-28 adenylate kinase family protein (.1.2) AT5G63400 107 / 1e-27 ADK1 adenylate kinase 1 (.1.2) AT5G50370 106 / 4e-27 Adenylate kinase family protein (.1) AT5G47840 97 / 2e-23 AMK2 adenosine monophosphate kinase (.1) AT4G25280 92 / 7e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G60180 81 / 5e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT5G26667 79 / 1e-17 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G046100 [exp] 483 / 2e-174 AT2G37250 377 / 1e-132 adenosine kinase (.1) Potri.001G333100 [exp] 153 / 8e-45 AT3G01820 249 / 8e-83 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.015G093200 [exp] 136 / 2e-38 AT3G01820 227 / 3e-74 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G095300 [exp] 106 / 3e-27 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2) Potri.018G113400 [exp] 110 / 7e-27 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2) Potri.015G092800 [exp] 104 / 2e-26 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2) Potri.013G103400 [exp] 99 / 4e-24 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1) Potri.019G078200 [exp] 98 / 1e-23 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1) Potri.002G134600 [exp] 86 / 7e-20 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040358 [exp] 440 / 3e-157 AT2G37250 405 / 1e-143 adenosine kinase (.1) Lus10023476 [exp] 439 / 7e-157 AT2G37250 407 / 2e-144 adenosine kinase (.1) Lus10001984 [exp] 430 / 3e-153 AT2G37250 391 / 4e-138 adenosine kinase (.1) Lus10030296 [exp] 429 / 5e-153 AT2G37250 395 / 1e-139 adenosine kinase (.1) Lus10022342 [exp] 162 / 3e-48 AT3G01820 255 / 4e-85 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10032057 [exp] 160 / 1e-47 AT3G01820 244 / 5e-81 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10035224 [exp] 158 / 1e-46 AT3G01820 242 / 3e-80 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10036326 [exp] 114 / 1e-28 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2) Lus10016757 [exp] 104 / 3e-26 AT5G63400 416 / 2e-149 adenylate kinase 1 (.1.2) Lus10022453 [exp] 101 / 2e-25 AT5G63400 411 / 2e-147 adenylate kinase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00406 [poplar] [flax] ADK Adenylate kinase
Representative CDS sequence Show only first row Show all	>Potri.010G215300.2 pacid=42798954 polypeptide=Potri.010G215300.2.p locus=Potri.010G215300 ID=Potri.010G215300.2.v4.1 annot-version=v4.1 ATGGCAGTTCTTTTAAGAAACCCTAAAACCATAACAAGAACAACAACATGTTCAATAAAACCACTCTCTTCCTGTATTTCTCGAAGTTTTTCCTCAACTA CGTTGAATTCCGAAACTGACCTCAAAGTACCTTCTTTTTTTTCTTGCATTTCCCCCCCTCTCCGTCAAGAACCTAAGGACAGAAATGTACAATGGGTGTT TCTTGGCTGTCCTGGTGTAGGTAAAGGCACCTATGCTTCCCGGCTTTCCAATCTTCTCGGTATTCCTCACATCGCCACCGGTGATCTGGTCCGCGAGGAG CTCAATTCCTCTGGCACACTTTCCTCCCAGCTTAAGGAGATTGTGAATCAAGGGAAATTGGTTTCTGATGAGATTATTATAAGCTTATTGTCGAAACGTC TTGAAGCTGGAGAAGCTAAGGGTGAGTCTGGTTTCATTCTTGATGGTTTCCCTCGAACTATTAGACAAGCGGAAATTTTAGAGGGAGTAACAGACATTGA CTTGGTGGTGAACCTAAAGCTTCGAGAAGAAGCTCTGCTTGCAAAATGCCTTGGGAGAAGGATTTGTAGTCAGTGTGGAGGAAATTACAACATTGCTTCC ATTGACATCAAGGGTGAGAATGGGAAGCCTGGAATTTACATGGCTCCACTTCCAGCTCCTCCACAATGTGTACCGAACCTTATCCAACGAGCTGATGATA CCAAAGAAGTTGTGAAGGAGCGACTTCGTATTTACAATGAAATGAGTCGACCTGTTGAGGAGTTCTACCGCAATCGTGGGAAGTTGTTGGAGTTTGATCT TCCTGGAGGAATTCCAGAATCCTGGCCAAAGCTGCTGGAAGCTCTGAATCTTGACCACGAGGATAAATGCACTGCAGCAGCATGA
AA sequence Show only first row Show all	>Potri.010G215300.2 pacid=42798954 polypeptide=Potri.010G215300.2.p locus=Potri.010G215300 ID=Potri.010G215300.2.v4.1 annot-version=v4.1 MAVLLRNPKTITRTTTCSIKPLSSCISRSFSSTTLNSETDLKVPSFFSCISPPLRQEPKDRNVQWVFLGCPGVGKGTYASRLSNLLGIPHIATGDLVREE LNSSGTLSSQLKEIVNQGKLVSDEIIISLLSKRLEAGEAKGESGFILDGFPRTIRQAEILEGVTDIDLVVNLKLREEALLAKCLGRRICSQCGGNYNIAS IDIKGENGKPGIYMAPLPAPPQCVPNLIQRADDTKEVVKERLRIYNEMSRPVEEFYRNRGKLLEFDLPGGIPESWPKLLEALNLDHEDKCTAAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37250		ADK, ATPADK1	adenosine kinase (.1)		Potri.010G215300 [exp]	0	1
AT5G40770		ATPHB3	prohibitin 3 (.1)		Potri.017G065800 [exp]	11.83	0.7914	PHB3.1
AT3G62120			Class II aaRS and biotin synth...		Potri.014G112400 [exp]	12.64	0.7649
AT1G23170			Protein of unknown function DU...		Potri.010G110500 [exp]	18.97	0.7577
AT1G63780		IMP4	Ribosomal RNA processing Brix ...		Potri.001G024500 [exp]	20.97	0.7547	Pt-IMP4.1
AT5G57490		VDAC4, ATVDAC4	ARABIDOPSIS THALIANA VOLTAGE D...		Potri.006G169400 [exp]	28.46	0.7473
AT4G32720		ATLA1	La protein 1 (.1.2)		Potri.006G241800 [exp]	28.46	0.7549
AT3G03960			TCP-1/cpn60 chaperonin family ...		Potri.013G058500 [exp]	29.93	0.7589
AT5G14040		PHT3;1	phosphate transporter 3;1 (.1)		Potri.017G060800 [exp]	30.00	0.6987
AT2G40010			Ribosomal protein L10 family p...		Potri.008G066300 [exp]	31.04	0.7674
AT3G20050		ATTCP-1	T-complex protein 1 alpha subu...		Potri.014G058500 [exp]	32.86	0.7548	BSTCP.1

Compare expression of checked genes

Potri.010G215300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.