Potri.010G217800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52300 282 / 8e-99 ATPQ "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G043800 322 / 2e-114 AT3G52300 291 / 3e-102 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038474 302 / 1e-106 AT3G52300 297 / 7e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10023337 300 / 7e-106 AT3G52300 298 / 2e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10023492 290 / 6e-102 AT3G52300 295 / 8e-104 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10040374 288 / 2e-101 AT3G52300 293 / 3e-103 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05873 Mt_ATP-synt_D ATP synthase D chain, mitochondrial (ATP5H)
Representative CDS sequence
>Potri.010G217800.1 pacid=42797779 polypeptide=Potri.010G217800.1.p locus=Potri.010G217800 ID=Potri.010G217800.1.v4.1 annot-version=v4.1
ATGAGCGGACCTTCAAAGAAAGTAGTGGATGTGGCATTTAAAGCATCGAAAACCGTTGATTGGGATGGGATGGCCAAGCTTTTAGTCTCCGATGAGGCTC
GCAAAGAGTTCGCTACTCTTCGTCGCGCTTTCAACGAAGTTAACGCCCAACTCGGGACCAAGTTCAGCCAGGAACCCGAACCCATAGACTGGGAATCTTA
CAGAAAAGGAATTGGCTCTCGCTTGGTGGACATGTACAAACAGGCATATGAAAGCGTAGAGATCCCTAAGTTTGAAGACAAAACGACTCCAGAATACAAG
CCTAAATTTGATCAATTGTTGGTGGATTTGAAAGAAGCAGAGCAACAATCCCTGAAGGAGTCTGAGCGCTTGGATAAAGAAATTGCTGATGTTCAAGAAT
TGAAGAAAAAAATCAGCACCATGACTGCAGAAGAGTACTTCGAGAAGCATCCTGAGCTGAAGAAAAAGTTTGATGATGAAATCCGTAATGACTATTGGGG
TTATTGA
AA sequence
>Potri.010G217800.1 pacid=42797779 polypeptide=Potri.010G217800.1.p locus=Potri.010G217800 ID=Potri.010G217800.1.v4.1 annot-version=v4.1
MSGPSKKVVDVAFKASKTVDWDGMAKLLVSDEARKEFATLRRAFNEVNAQLGTKFSQEPEPIDWESYRKGIGSRLVDMYKQAYESVEIPKFEDKTTPEYK
PKFDQLLVDLKEAEQQSLKESERLDKEIADVQELKKKISTMTAEEYFEKHPELKKKFDDEIRNDYWGY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Potri.010G217800 0 1
AT2G20820 unknown protein Potri.013G146000 1.41 0.9515
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Potri.001G171200 1.41 0.9511
AT5G48580 FKBP15-2 FK506- and rapamycin-binding p... Potri.002G248200 2.44 0.9479
AT2G20820 unknown protein Potri.019G109100 3.46 0.9437
AT5G44710 unknown protein Potri.003G155000 4.69 0.9149
AT3G22845 emp24/gp25L/p24 family/GOLD fa... Potri.010G081700 4.79 0.9138
AT5G52840 NADH-ubiquinone oxidoreductase... Potri.004G071900 5.47 0.9461
AT2G21870 MGP1 MALE GAMETOPHYTE DEFECTIVE 1, ... Potri.007G079500 5.65 0.9232
AT3G25040 ERD2B endoplasmic reticulum retentio... Potri.001G315800 6.70 0.9380
AT4G37830 cytochrome c oxidase-related (... Potri.007G008800 7.48 0.9422

Potri.010G217800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.