Potri.010G218001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G043600 56 / 4e-11 AT2G26430 475 / 1e-166 arginine-rich cyclin 1 (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036509 42 / 6e-06 AT2G26430 411 / 2e-143 arginine-rich cyclin 1 (.1.2.3)
Lus10041418 37 / 0.0003 AT2G26430 475 / 2e-163 arginine-rich cyclin 1 (.1.2.3)
PFAM info
Representative CDS sequence
>Potri.010G218001.1 pacid=42797984 polypeptide=Potri.010G218001.1.p locus=Potri.010G218001 ID=Potri.010G218001.1.v4.1 annot-version=v4.1
ATGAAATTGAAAGAGACAGGGATAGAGGTAAGGATCGAGGTCATCCTCGTTCAAAGGATAGAGGAAGAGAATCAGGCCACTCGGAGAAATCAAGGCATCA
TTCATCACACGGTGTGTCTTTTAACTGGCCTTCCGAGGTTCATCTTTTTTCCTTCGTGCACGTGTGTGGCAGTCCTCTTATCGGCGACTATTTTGCATTT
TTAG
AA sequence
>Potri.010G218001.1 pacid=42797984 polypeptide=Potri.010G218001.1.p locus=Potri.010G218001 ID=Potri.010G218001.1.v4.1 annot-version=v4.1
MKLKETGIEVRIEVILVQRIEEENQATRRNQGIIHHTVCLLTGLPRFIFFPSCTCVAVLLSATILHF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G26430 ATRCY1, RCY1 arginine-rich cyclin 1 (.1.2.3... Potri.010G218001 0 1
AT2G18950 ATHPT, VTE2, TP... VITAMIN E 2, homogentisate phy... Potri.018G022000 3.16 0.8177
AT4G27330 NZZ NZZ, SPL NOZZLE, sporocyteless (SPL) (.... Potri.011G125600 4.89 0.6630
AT5G55390 EDM2 ENHANCED DOWNY MILDEW 2 (.1.2) Potri.014G163301 7.48 0.7254
Potri.010G224650 15.19 0.6468
AT3G26660 AS2 LBD24 LOB domain-containing protein ... Potri.015G135900 18.33 0.6011 LBD23.2
AT5G53820 Late embryogenesis abundant pr... Potri.004G107700 29.24 0.5604
Potri.004G127001 30.57 0.5151
AT4G30390 unknown protein Potri.019G051850 52.64 0.5165
Potri.009G126100 59.96 0.4985
AT2G35040 AICARFT/IMPCHase bienzyme fami... Potri.008G128301 77.36 0.4947

Potri.010G218001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.