Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54890 393 / 2e-140 LHCA1 photosystem I light harvesting complex gene 1 (.1.2.3.4) AT3G08940 150 / 5e-44 LHCB4.2 light harvesting complex photosystem II (.1.2) AT5G01530 149 / 1e-43 LHCB4.1 light harvesting complex photosystem II (.1) AT3G47470 138 / 6e-40 CAB4, LHCA4 light-harvesting chlorophyll-protein complex I subunit A4 (.1) AT4G10340 138 / 2e-39 LHCB5 light harvesting complex of photosystem II 5 (.1) AT1G45474 136 / 3e-39 LHCA5 photosystem I light harvesting complex gene 5 (.1.2) AT2G34430 136 / 4e-39 LHCB1.4, LHB1B1 light-harvesting chlorophyll-protein complex II subunit B1 (.1) AT2G34420 136 / 4e-39 LHCB1.5, LHB1B2 PHOTOSYSTEM II LIGHT HARVESTING COMPLEX GENE 1.5, photosystem II light harvesting complex gene B1B2 (.1) AT3G61470 135 / 6e-39 LHCA2 photosystem I light harvesting complex gene 2 (.1) AT1G29920 135 / 9e-39 AB165, LHCB1.1, CAB2 LIGHT HARVESTING CHLOROPHYLL A/B-BINDING PROTEIN 1.1, chlorophyll A/B-binding protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G041000 [exp] 439 / 2e-158 AT3G54890 395 / 4e-141 photosystem I light harvesting complex gene 1 (.1.2.3.4) Potri.016G115200 [exp] 148 / 2e-43 AT3G08940 449 / 4e-161 light harvesting complex photosystem II (.1.2) Potri.006G099500 [exp] 145 / 3e-42 AT3G08940 474 / 7e-171 light harvesting complex photosystem II (.1.2) Potri.003G171500 [exp] 140 / 1e-40 AT3G61470 409 / 5e-146 photosystem I light harvesting complex gene 2 (.1) Potri.001G056700 [exp] 140 / 2e-40 AT3G61470 410 / 3e-146 photosystem I light harvesting complex gene 2 (.1) Potri.015G062200 [exp] 139 / 2e-40 AT3G47470 442 / 2e-159 light-harvesting chlorophyll-protein complex I subunit A4 (.1) Potri.019G063101 [exp] 137 / 4e-39 AT4G10340 409 / 2e-145 light harvesting complex of photosystem II 5 (.1) Potri.006G139600 [exp] 134 / 2e-38 AT1G19150 393 / 1e-139 photosystem I light harvesting complex gene 6 (.1) Potri.005G239200 [exp] 131 / 5e-37 AT2G34430 484 / 2e-175 light-harvesting chlorophyll-protein complex II subunit B1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040391 [exp] 367 / 1e-129 AT3G54890 371 / 1e-131 photosystem I light harvesting complex gene 1 (.1.2.3.4) Lus10023509 [exp] 362 / 4e-128 AT3G54890 367 / 3e-130 photosystem I light harvesting complex gene 1 (.1.2.3.4) Lus10021663 [exp] 148 / 1e-43 AT3G47470 434 / 2e-156 light-harvesting chlorophyll-protein complex I subunit A4 (.1) Lus10035512 [exp] 148 / 2e-43 AT3G08940 459 / 4e-165 light harvesting complex photosystem II (.1.2) Lus10001644 [exp] 147 / 4e-43 AT3G47470 437 / 3e-157 light-harvesting chlorophyll-protein complex I subunit A4 (.1) Lus10011361 [exp] 138 / 1e-39 AT3G61470 414 / 6e-148 photosystem I light harvesting complex gene 2 (.1) Lus10006416 [exp] 137 / 3e-39 AT3G61470 404 / 6e-144 photosystem I light harvesting complex gene 2 (.1) Lus10039912 [exp] 136 / 5e-39 AT1G19150 362 / 2e-127 photosystem I light harvesting complex gene 6 (.1) Lus10037836 [exp] 136 / 1e-38 AT2G40100 399 / 2e-141 light harvesting complex photosystem II (.1.2) Lus10008594 [exp] 135 / 1e-38 AT1G29930 445 / 4e-160 LIGHT-HARVESTING CHLOROPHYLL A/B-PROTEIN 1.3, CHLOROPHYLL A/B PROTEIN 140, chlorophyll A/B binding protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00504 [poplar] [flax] Chloroa_b-bind Chlorophyll A-B binding protein
Representative CDS sequence Show only first row Show all	>Potri.010G221100.4 pacid=42799129 polypeptide=Potri.010G221100.4.p locus=Potri.010G221100 ID=Potri.010G221100.4.v4.1 annot-version=v4.1 ATGGCCACCAATACATTGATGAGCTGCGGCATTGCCACCGCTTTCCCTTCACTTCTTTCATCTTCAAAGTCCAAATTCGCCTCTTCAATTCCACTTCCCA GTGTCAATGGCACCTCTCGTGTCACCATGTCTGCTAACTGGATGCCAGGCCAGCCTCGTCCACCTTACCTCGATGGCTCAGCCCCCGGTGACTTTGGGTT CGACCCACTTCGACTGGGCGAGGTCCCTGAGAATCTGGAGAGATACAAGGAGTCCGAACTCATTCACTGCAGATGGGCTATGCTTGCTGTTCCTGGAATT CTGGTACCAGAGGCCCTGGGTCTGGGCAACTGGGTAAAAGCTCAAGAGTGGGCTGCAACTCCAGGTGGCCAAGCTACTTATCTGGGCCAACCAGTTCCAT GGGGAACCCTCCCTATCATTCTGGCCATTGAATTCGTTGCCATTGCCTTTGTTGAGCACCAACGTAGCATGGAGAAAGACACAGAGAAGAAGAAGTACCC TGGTGGTGCTTTTGATCCTCTAGGATACTCCAAGGACCCTCAGAAGTTCGAGGAATACAAAGTCAAGGAAATTAAGAATGGCCGTCTAGCACTGTTGGCA TTTGTTGGGATCTGTGTGCAACAAACAGCTTATCCTGGTACTGGACCATTGGAGAACTTGGCAACTCACCTGGCTGACCCATGGCACAACAACATCGGGG ACGTTCTCATCCCTAGATCGGTCTCGCCTTGA
AA sequence Show only first row Show all	>Potri.010G221100.4 pacid=42799129 polypeptide=Potri.010G221100.4.p locus=Potri.010G221100 ID=Potri.010G221100.4.v4.1 annot-version=v4.1 MATNTLMSCGIATAFPSLLSSSKSKFASSIPLPSVNGTSRVTMSANWMPGQPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGI LVPEALGLGNWVKAQEWAATPGGQATYLGQPVPWGTLPIILAIEFVAIAFVEHQRSMEKDTEKKKYPGGAFDPLGYSKDPQKFEEYKVKEIKNGRLALLA FVGICVQQTAYPGTGPLENLATHLADPWHNNIGDVLIPRSVSP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G54890		LHCA1	photosystem I light harvesting...		Potri.010G221100 [exp]	0	1	1
AT3G47470		CAB4, LHCA4	light-harvesting chlorophyll-p...		Potri.015G062200 [exp]	1.00	0.9915	CAB4.1
AT3G08940		LHCB4.2	light harvesting complex photo...		Potri.016G115200 [exp]	2.00	0.9906	Pt-LHCB4.2
AT3G08940		LHCB4.2	light harvesting complex photo...		Potri.006G099500 [exp]	2.44	0.9896	LHCB4.3,Lhcb4
AT5G67150			HXXXD-type acyl-transferase fa...		Potri.003G057200 [exp]	3.16	0.9855
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Potri.016G021300 [exp]	3.46	0.9830
AT3G56940		CRD1, CHL27, AC...	COPPER RESPONSE DEFECT 1, dica...		Potri.006G027300 [exp]	3.46	0.9861	Pt-AT103.2
AT3G56940		CRD1, CHL27, AC...	COPPER RESPONSE DEFECT 1, dica...		Potri.016G025000 [exp]	3.74	0.9817	AT103.1
AT1G21500			unknown protein		Potri.013G128700 [exp]	8.48	0.9612
AT3G61470		LHCA2	photosystem I light harvesting...		Potri.001G056700 [exp]	8.48	0.9817
AT1G61520		LHCA3*1, LHCA3*...	photosystem I light harvesting...		Potri.014G172400 [exp]	10.81	0.9757	LHCA3*1.1,Lhca3

Compare expression of checked genes

Potri.010G221100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.