Plant FIBer expression Database

Potri.010G222400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G49015 53 / 2e-10 Expressed protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G039901
[exp]
122 / 6e-37 AT5G49015 57 / 3e-11 Expressed protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041398
[exp]
62 / 4e-14 AT5G49015 40 / 1e-05 Expressed protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.010G222400.1 pacid=42800071 polypeptide=Potri.010G222400.1.p locus=Potri.010G222400 ID=Potri.010G222400.1.v4.1 annot-version=v4.1
ATGCATCTATGGCCAACGATGAGAATAAGGGACTCCTTCAAGATTGCTTACTTGAAAAAACTTGAATGGAATTTTCATAGAATGAACATTGAAAAGAAGC
AGAAGTCTCAAGAAACTAGCGACAGCAACCAGCAAAGACTCTTGGATGATGGTGATGATAACAGTACTAACCAACAACAACCAGTAAAAGCTTCTAAAGT
TGTTTTGATTTGCAGAGAGATTCTCATGCTCGTCACTTGTTGCTACTGTTGTTTCTGTTGTGGAGCTTGTGTCGACCAAGACGAGGAATGA
AA sequence
>Potri.010G222400.1 pacid=42800071 polypeptide=Potri.010G222400.1.p locus=Potri.010G222400 ID=Potri.010G222400.1.v4.1 annot-version=v4.1
MHLWPTMRIRDSFKIAYLKKLEWNFHRMNIEKKQKSQETSDSNQQRLLDDGDDNSTNQQQPVKASKVVLICREILMLVTCCYCCFCCGACVDQDEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G49015 Expressed protein (.1.2) Potri.010G222400
[exp]
0 1
AT4G02340 alpha/beta-Hydrolases superfam... Potri.014G127200
[exp]
5.09 0.8113
AT5G64830 programmed cell death 2 C-term... Potri.007G080500
[exp]
37.10 0.6953
AT2G29700 ATPH1 pleckstrin homologue 1 (.1) Potri.001G250400
[exp]
83.66 0.6154 Pt-ATPH1.2
AT1G55915 zinc ion binding (.1) Potri.008G009700
[exp]
85.04 0.6395
Potri.007G026601
[exp]
85.92 0.6534
AT4G01500 B3 NGA4 NGATHA4, AP2/B3-like transcrip... Potri.015G014850
[exp]
94.84 0.6631
AT1G72690 unknown protein Potri.004G095300
[exp]
112.52 0.6181
Potri.008G175200
[exp]
123.22 0.6281
AT3G14690 CYP72A15 "cytochrome P450, family 72, s... Potri.011G099800
[exp]
159.87 0.6462
AT5G48820 ICK6, KRP3 KIP-RELATED PROTEIN 3, inhibit... Potri.002G242100
[exp]
178.99 0.6156

Potri.010G222400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.