Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42300 144 / 2e-47 UBL5 ubiquitin-like protein 5 (.1) AT3G45180 139 / 3e-45 Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G039100 [exp] 145 / 1e-47 AT5G42300 147 / 2e-48 ubiquitin-like protein 5 (.1) Potri.004G211600 [exp] 141 / 3e-46 AT3G45180 143 / 1e-46 Ubiquitin-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019939 [exp] 144 / 5e-47 AT5G42300 141 / 5e-46 ubiquitin-like protein 5 (.1) Lus10023188 [exp] 143 / 1e-46 AT5G42300 140 / 1e-45 ubiquitin-like protein 5 (.1) Lus10002228 [exp] 143 / 1e-46 AT5G42300 140 / 1e-45 ubiquitin-like protein 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF00240 [poplar] [flax] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Potri.010G223100.3 pacid=42799164 polypeptide=Potri.010G223100.3.p locus=Potri.010G223100 ID=Potri.010G223100.3.v4.1 annot-version=v4.1 ATGTTGGAGGTGGTGTTGAACGACCGTTTGGGAAAGAAAGTGAGAGTGAAGTGCAACGACGACGACACCATCGGTGACCTCAAGAAGCTCGTGGCGGCAC AGACCGGTACCCGGGCTGAGAAGATCCGGATCCAGAAGTGGTACACCATTTACAAAGACCATATTACCCTCAGGGATTACGAGATTCATGATGGCATGGG CCTCGAGCTCTACTACAACTAA
AA sequence Show only first row Show all	>Potri.010G223100.3 pacid=42799164 polypeptide=Potri.010G223100.3.p locus=Potri.010G223100 ID=Potri.010G223100.3.v4.1 annot-version=v4.1 MLEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRAEKIRIQKWYTIYKDHITLRDYEIHDGMGLELYYN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Potri.010G223100 [exp]	0	1
AT3G12490		ATCYS6, ATCYSB	ARABIDOPSIS THALIANA PHYTOCYST...		Potri.006G033201 [exp]	3.46	0.8775
AT5G61220			LYR family of Fe/S cluster bio...		Potri.009G079800 [exp]	3.46	0.8932
AT4G10810			unknown protein		Potri.002G173700 [exp]	4.47	0.8696
AT2G43810			Small nuclear ribonucleoprotei...		Potri.010G178700 [exp]	5.74	0.8761
AT3G13200		EMB2769	EMBRYO DEFECTIVE 2769, Cwf15 /...		Potri.001G370366 [exp]	8.77	0.8425
AT3G06780			glycine-rich protein (.1)		Potri.008G211000 [exp]	11.74	0.8520
AT2G24360			Protein kinase superfamily pro...		Potri.006G279900 [exp]	29.39	0.8354
AT2G44200			CBF1-interacting co-repressor ...		Potri.006G000200 [exp]	30.98	0.8326
AT2G19270			unknown protein		Potri.006G075000 [exp]	34.62	0.8318
AT1G04985			unknown protein		Potri.014G159600 [exp]	35.63	0.8534

Compare expression of checked genes

Potri.010G223100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.