Plant FIBer expression Database

Potri.010G224650 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58248 36 / 0.0002 Plant thionin family protein (.1)
AT1G58242 36 / 0.0002 Plant thionin family protein (.1)
AT5G36805 35 / 0.0003 Plant thionin family protein (.1)
AT5G36720 35 / 0.0003 Plant thionin family protein (.1)
AT5G38378 35 / 0.0003 Plant thionin family protein (.1)
AT5G34828 35 / 0.0004 Plant thionin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.010G224650.1 pacid=42799590 polypeptide=Potri.010G224650.1.p locus=Potri.010G224650 ID=Potri.010G224650.1.v4.1 annot-version=v4.1
ATGGCCATCAAGAAAATCGTCGCCGCCTTCCTCATCTTGACATTTCTTGTCATGGTATGTGCAGTCGATGACCCATTGACAACATGTGTCAATAGCTGTC
TTCCACAATGCATTGAAACTGCACCAAGTTCATTACGGCCTAAATGTGAGGCAGCCTGCCTGGAATTTTGCACAGCTCATTGA
AA sequence
>Potri.010G224650.1 pacid=42799590 polypeptide=Potri.010G224650.1.p locus=Potri.010G224650 ID=Potri.010G224650.1.v4.1 annot-version=v4.1
MAIKKIVAAFLILTFLVMVCAVDDPLTTCVNSCLPQCIETAPSSLRPKCEAACLEFCTAH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G224650
[exp]
0 1
AT5G55390 EDM2 ENHANCED DOWNY MILDEW 2 (.1.2) Potri.014G163301
[exp]
2.00 0.9361
AT5G03980 SGNH hydrolase-type esterase s... Potri.005G024933
[exp]
3.16 0.7757
AT4G30390 unknown protein Potri.019G051850
[exp]
3.87 0.7262
AT2G18950 ATHPT, VTE2, TP... VITAMIN E 2, homogentisate phy... Potri.018G022000
[exp]
4.47 0.8550
AT5G53820 Late embryogenesis abundant pr... Potri.004G107700
[exp]
5.65 0.7244
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Potri.012G072500
[exp]
5.83 0.7025 Pt-MYB.54,MYB198
Potri.004G127001
[exp]
6.16 0.6627
AT3G03760 AS2 LBD20 LOB domain-containing protein ... Potri.013G064501
[exp]
8.94 0.6598
AT2G35040 AICARFT/IMPCHase bienzyme fami... Potri.008G128301
[exp]
11.48 0.6138
AT2G26430 ATRCY1, RCY1 arginine-rich cyclin 1 (.1.2.3... Potri.010G218001
[exp]
15.19 0.6468

Potri.010G224650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.