Potri.010G225400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04250 360 / 1e-123 Cysteine proteinases superfamily protein (.1.2)
AT5G03330 263 / 3e-85 Cysteine proteinases superfamily protein (.1.2)
AT3G02070 236 / 7e-77 Cysteine proteinases superfamily protein (.1)
AT3G22260 202 / 3e-63 Cysteine proteinases superfamily protein (.1.2.3)
AT2G39320 100 / 6e-25 Cysteine proteinases superfamily protein (.1)
AT5G67170 62 / 2e-10 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 61 / 7e-10 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G036700 532 / 0 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2)
Potri.006G125900 320 / 1e-107 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Potri.016G094700 311 / 2e-104 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036900 259 / 2e-86 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.014G140200 233 / 3e-75 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.016G019700 225 / 3e-72 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G021700 221 / 1e-70 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.005G140500 70 / 6e-13 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.009G160100 58 / 6e-09 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038708 413 / 6e-144 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 413 / 7e-144 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10037388 290 / 2e-96 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 275 / 5e-90 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10001404 275 / 5e-90 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10013813 265 / 5e-86 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10026525 259 / 4e-84 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10010459 212 / 3e-67 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027312 209 / 2e-65 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10003816 184 / 2e-56 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.010G225400.7 pacid=42798894 polypeptide=Potri.010G225400.7.p locus=Potri.010G225400 ID=Potri.010G225400.7.v4.1 annot-version=v4.1
ATGATTGTATTTGAGCAGGATCCTGATGTTGTTCGATGGGGTCTCCATAATCTAATACAGGATTGTACACTTCCGAATTCTGGTTCGTGTTATGCTGTTA
CTCGTCATGACAGGGATACATTTAATGCTGGGTATGTTAGAGAAAATTATAATGATCCAGAATATGCAAATAATGTGGAGAACGATGCTGTTATTGCTCG
TGCTCTTCAAGAAGAACTTTCACGGATTGCTGATGCGGAATCATTTGGGTTAAATAACGCTGAACAAGAATCAATTATTATGCAGCTATGGCCTTGTTCT
CATGAAAAATACCATGGTTCTGAGCACAAGAACAGTCAGGAAGTCACAAATGATCACTGTGAAAACAAAACGGGTGTTGACAATCACAGCAAAAATGTAG
CAGATGACTCTAGCAAGAAGGATGAAACAGCGATCCCTACTTCATCTTCTAAAAGTGAAGAAGATTCCCTTAATATGGAAGAGTTGGCAATTAATTCAAA
CTTAGCAAATGAATACGCTCTTGATGGTGAAGTGGGCAAGAGGATAAGCGATATGGTTCCTATTCCTCTTGTTCCTAAAACTAATGGAGAAATACCATCA
GAAGATGCAGAGACATCAGATCATCAAAGGCTGCTAGACAGGTTAAAGGTATATGATCTTGTTGAGAATAAGGTTCTAGGAGATGGTAACTGTCAGTTTC
GTTCCCTGTCAGATCAACTCTACCGTTCTCCTGAGCACCACAAACTGGTGAGAGAACAAGTTATTGATCAGCTCAAGTCTCAGCCGCAAATGTACGAGGG
CTATGTTCCTATGGCTTATGATGACTATCTGAAGAAAATGAGCAAGGGTGGTGAATGGGGTGATCACATCACATTGCAGGCTGCTGCAGATTCGTATGGT
GTCAAGATATTTGTGATTACTTCATTCAAGGATACATGTTACCTCGAGATCCTTCCACAGGCTCAAAAGTCCGATCGGGTTATTTTCTTGAGCTTTTGGG
CGGAGGTGCACTACAATTCAATATACTCAGAAGGAGTTGGAATCGAAGAAAAAAGACTGGTGGAAGATTTGAAGCTGGGAACTTCATCGGCAAAGCTCAT
AAGAAGATGCTTCTGTGCTACATGA
AA sequence
>Potri.010G225400.7 pacid=42798894 polypeptide=Potri.010G225400.7.p locus=Potri.010G225400 ID=Potri.010G225400.7.v4.1 annot-version=v4.1
MIVFEQDPDVVRWGLHNLIQDCTLPNSGSCYAVTRHDRDTFNAGYVRENYNDPEYANNVENDAVIARALQEELSRIADAESFGLNNAEQESIIMQLWPCS
HEKYHGSEHKNSQEVTNDHCENKTGVDNHSKNVADDSSKKDETAIPTSSSKSEEDSLNMEELAINSNLANEYALDGEVGKRISDMVPIPLVPKTNGEIPS
EDAETSDHQRLLDRLKVYDLVENKVLGDGNCQFRSLSDQLYRSPEHHKLVREQVIDQLKSQPQMYEGYVPMAYDDYLKKMSKGGEWGDHITLQAAADSYG
VKIFVITSFKDTCYLEILPQAQKSDRVIFLSFWAEVHYNSIYSEGVGIEEKRLVEDLKLGTSSAKLIRRCFCAT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G04250 Cysteine proteinases superfami... Potri.010G225400 0 1
AT5G02220 unknown protein Potri.008G057600 1.41 0.8164
AT1G78070 Transducin/WD40 repeat-like su... Potri.002G094100 2.44 0.7796
AT1G29500 SAUR-like auxin-responsive pro... Potri.002G064150 3.46 0.7263
AT2G38280 ATAMPD, FAC1 EMBRYONIC FACTOR1, ADENOSINE 5... Potri.016G119300 8.00 0.6944
AT5G01300 PEBP (phosphatidylethanolamine... Potri.016G121000 19.13 0.7023
AT3G51750 unknown protein Potri.006G103600 24.49 0.6011
AT2G04100 MATE efflux family protein (.1... Potri.017G120400 27.49 0.6737
Potri.001G220400 27.74 0.7017
AT4G24970 Histidine kinase-, DNA gyrase ... Potri.015G100900 31.98 0.6741
AT5G03980 SGNH hydrolase-type esterase s... Potri.005G024966 33.68 0.7084

Potri.010G225400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.