Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04260 204 / 4e-67 WCRKC2 WCRKC thioredoxin 2 (.1) AT5G06690 155 / 1e-47 WCRKC1 WCRKC thioredoxin 1 (.1.2) AT1G03680 50 / 8e-08 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT3G15360 50 / 9e-08 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT4G03520 47 / 2e-06 ATHM2 Thioredoxin superfamily protein (.1.2) AT1G52990 47 / 3e-06 thioredoxin family protein (.1) AT2G35010 44 / 1e-05 ATO1 thioredoxin O1 (.1.2) AT5G39950 42 / 4e-05 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT3G17880 42 / 0.0002 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT2G41680 40 / 0.0006 NTRC NADPH-dependent thioredoxin reductase C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G036400 [exp] 291 / 2e-101 AT5G04260 216 / 8e-72 WCRKC thioredoxin 2 (.1) Potri.016G059500 [exp] 160 / 9e-50 AT5G06690 212 / 4e-70 WCRKC thioredoxin 1 (.1.2) Potri.005G186800 [exp] 52 / 3e-08 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.001G401500 [exp] 52 / 4e-08 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.013G132200 [exp] 50 / 9e-08 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.019G111200 [exp] 49 / 4e-07 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.002G073000 [exp] 49 / 5e-07 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.005G058400 [exp] 46 / 2e-06 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.017G076700 [exp] 45 / 5e-06 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038703 [exp] 200 / 7e-65 AT5G04260 191 / 2e-61 WCRKC thioredoxin 2 (.1) Lus10037975 [exp] 152 / 5e-48 AT5G04260 149 / 3e-47 WCRKC thioredoxin 2 (.1) Lus10021067 [exp] 149 / 2e-45 AT5G06690 215 / 3e-71 WCRKC thioredoxin 1 (.1.2) Lus10017244 [exp] 104 / 4e-28 AT5G06690 156 / 2e-48 WCRKC thioredoxin 1 (.1.2) Lus10042784 [exp] 47 / 1e-06 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 47 / 2e-06 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 46 / 2e-06 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014798 [exp] 45 / 4e-06 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10020691 [exp] 46 / 5e-06 AT2G47470 473 / 3e-168 UNFERTILIZED EMBRYO SAC 5, MATERNAL EFFECT EMBRYO ARREST 30, PDI-LIKE 2-1, ARABIDOPSIS THALIANA PROTEIN DISULFIDE ISOMERASE 11, thioredoxin family protein (.1.2.3.4) Lus10040887 [exp] 45 / 6e-06 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.010G225701.1 pacid=42796828 polypeptide=Potri.010G225701.1.p locus=Potri.010G225701 ID=Potri.010G225701.1.v4.1 annot-version=v4.1 ATGTCTAAGATCTTACAGAACCCACCATCTCTCAGACTGTTGTCTTCAAATTCGATCCCACGTGACTTGTCAATATTAAGCATTCCTTGTCAAAACCCCT CAATTTTGATCTCTAAGAAACTTTCTCCTGGAAAATTCATTCTTCCCGGGAAAATTCATGGGTTTGAAGGGGGAAATGGAATCTTTCATGCTTGGAGCCA AGAGGGGTCTCTGCAAGAGGTGGATGATTCTCCTGTATCGTTTGAGTTGGAGCCCATTTACAGTGAGAGCCAGTTTGATCGTGTGATAGCAGAGGCACAG CAGCTTGTGGAATCTGTTATCATTGTTTGGATGGCAAGCTGGTGCAGAAAATGTATATATTTGAAACCAAAATTGGAAAAGTTGGCAGCTGATTACAATA GAAGATTGCGGTTTTACTGTGTCAATGTTAATAATATCCCACACAAACTTGTTGCTCGTGCAGGAGTTACTAAAATGCCAACTATTCAGTTATGGAAGGA TAGCAAGAAACAGGCAGAAGTGATTGGTGGTCACAAAGCATATTTGGTCATTAATGAAGTTCGTGAAATGATTGAAAATGAGGGTACCTTGTGA
AA sequence Show only first row Show all	>Potri.010G225701.1 pacid=42796828 polypeptide=Potri.010G225701.1.p locus=Potri.010G225701 ID=Potri.010G225701.1.v4.1 annot-version=v4.1 MSKILQNPPSLRLLSSNSIPRDLSILSIPCQNPSILISKKLSPGKFILPGKIHGFEGGNGIFHAWSQEGSLQEVDDSPVSFELEPIYSESQFDRVIAEAQ QLVESVIIVWMASWCRKCIYLKPKLEKLAADYNRRLRFYCVNVNNIPHKLVARAGVTKMPTIQLWKDSKKQAEVIGGHKAYLVINEVREMIENEGTL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G04260		WCRKC2	WCRKC thioredoxin 2 (.1)		Potri.010G225701 [exp]	0	1
AT2G20930			SNARE-like superfamily protein...		Potri.004G176500 [exp]	1.00	0.8977
AT1G75340	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Potri.006G081100 [exp]	4.58	0.8409
AT5G07610			F-box family protein (.1)		Potri.008G016300 [exp]	5.47	0.8738
AT1G61670			Lung seven transmembrane recep...		Potri.006G109000 [exp]	7.21	0.8557
AT1G66920			Protein kinase superfamily pro...		Potri.015G018600 [exp]	8.66	0.8553
AT5G18070		DRT101	DNA-DAMAGE-REPAIR/TOLERATION 1...		Potri.001G146900 [exp]	12.72	0.8038	Pt-DRT101.2
AT3G16090		AtHrd1A	homolog of yeast Hrd1, RING/U-...		Potri.013G088400 [exp]	14.49	0.8295
AT3G27700	C3HZnF		zinc finger (CCCH-type) family...		Potri.001G351532 [exp]	15.49	0.8270
AT3G11340		UGT76B1	UDP-dependent glycosyltransfer...		Potri.010G195500 [exp]	16.24	0.8088
AT3G60800			DHHC-type zinc finger family p...		Potri.001G117100 [exp]	16.43	0.8482

Compare expression of checked genes

Potri.010G225701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.