Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ARA6.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54840 374 / 5e-134 ARA6, AtRABF1, Ara-6, AtRab5C Ras-related small GTP-binding family protein (.1.2) AT4G19640 220 / 3e-73 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) AT5G45130 219 / 9e-73 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) AT4G39990 167 / 4e-52 ATGB3, AtRABA4b, AtRab11G ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A 4B, GTP-BINDING PROTEIN 3, RAB GTPase homolog A4B (.1) AT1G16920 166 / 7e-52 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT4G18430 165 / 1e-51 AtRABA1e RAB GTPase homolog A1E (.1) AT1G09630 165 / 2e-51 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT5G65270 164 / 3e-51 AtRABA4a RAB GTPase homolog A4A (.1) AT3G15060 163 / 1e-50 AtRABA1g RAB GTPase homolog A1G (.1) AT5G45750 160 / 2e-49 AtRABA1c RAB GTPase homolog A1C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G035800 [exp] 409 / 3e-148 AT3G54840 367 / 3e-131 Ras-related small GTP-binding family protein (.1.2) Potri.012G117800 [exp] 224 / 7e-75 AT5G45130 357 / 1e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.018G079300 [exp] 223 / 3e-74 AT5G45130 273 / 2e-94 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.015G113000 [exp] 222 / 5e-74 AT5G45130 339 / 2e-120 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.003G054900 [exp] 221 / 6e-74 AT4G19640 270 / 4e-93 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Potri.007G096000 [exp] 168 / 1e-52 AT5G65270 404 / 2e-145 RAB GTPase homolog A4A (.1) Potri.003G004100 [exp] 167 / 4e-52 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.005G073000 [exp] 167 / 4e-52 AT5G65270 402 / 1e-144 RAB GTPase homolog A4A (.1) Potri.004G061000 [exp] 163 / 8e-51 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028820 [exp] 364 / 3e-130 AT3G54840 354 / 3e-126 Ras-related small GTP-binding family protein (.1.2) Lus10017462 [exp] 361 / 2e-126 AT3G54840 349 / 1e-121 Ras-related small GTP-binding family protein (.1.2) Lus10038334 [exp] 227 / 6e-76 AT5G45130 349 / 3e-124 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10040625 [exp] 213 / 1e-70 AT5G45130 355 / 6e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10018285 [exp] 211 / 1e-69 AT5G45130 359 / 3e-128 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10034903 [exp] 201 / 2e-65 AT5G45130 258 / 2e-88 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10035924 [exp] 168 / 2e-52 AT5G65270 404 / 3e-145 RAB GTPase homolog A4A (.1) Lus10025738 [exp] 167 / 3e-52 AT5G65270 404 / 4e-145 RAB GTPase homolog A4A (.1) Lus10020746 [exp] 166 / 1e-51 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10000637 [exp] 164 / 5e-51 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.010G226300.3 pacid=42797670 polypeptide=Potri.010G226300.3.p locus=Potri.010G226300 ID=Potri.010G226300.3.v4.1 annot-version=v4.1 ATGGGTTGCTCCTCTTCTCTTCCAGATAGGAGTACTGGGAGATTGGGTGGACTTAACAATTCAGAGAGTGGTGGAGTGGCTGATGCCAAAAACCTACGCG TAAAGCTGGTTTTATTAGGTGATTCTGGTGTTGGTAAAAGCTGTATTGTTCTTCGCTTTGTTCGTGGCCAGTTTGATCCAACATCCAAGGTAACTATTGG AGCTTCATTTTTGTCACAAACAATAGCTTTACAGGATTCTACAACAATTAAGTTTGAGATATGGGATACTGCTGGACAAGAAAGGTATGCCGCACTAGCA CCGCTATATTACAGAGGTGCTGCAGTTGCAGTTATTGTGTACGATATAACAAGCCCAGAGACATTCAACAAAGCACAGTATTGGGTTAAGGAGCTACAAA AACATGGGAGCCCTGATATAGTCATGGCTTTAGTAGGTAACAAGGCTGATCTTCATGAGAAGCGAGAAGTACCCACTCAAGATGGCATTGAATATGCGGA GAAGAATGGGATGTTCTTTATTGAGACATCTGCAAAAACTGCAGATAATATAAATCAACTGTTTGAGGAAATTGCTAAGCGACTCCCGCGCCCTTCCTCA ACATGA
AA sequence Show only first row Show all	>Potri.010G226300.3 pacid=42797670 polypeptide=Potri.010G226300.3.p locus=Potri.010G226300 ID=Potri.010G226300.3.v4.1 annot-version=v4.1 MGCSSSLPDRSTGRLGGLNNSESGGVADAKNLRVKLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTIGASFLSQTIALQDSTTIKFEIWDTAGQERYAALA PLYYRGAAVAVIVYDITSPETFNKAQYWVKELQKHGSPDIVMALVGNKADLHEKREVPTQDGIEYAEKNGMFFIETSAKTADNINQLFEEIAKRLPRPSS T

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G54840		ARA6, AtRABF1, ...	Ras-related small GTP-binding ...		Potri.010G226300 [exp]	0	1	ARA6.1
AT1G54390		ING2	INHIBITOR OF GROWTH 2, PHD fin...		Potri.019G033800 [exp]	3.00	0.6735
AT4G17070			peptidyl-prolyl cis-trans isom...		Potri.001G150300 [exp]	8.00	0.6210
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Potri.010G208900 [exp]	8.12	0.6108	Pt-RAB1.10
AT1G25380		ATNDT2	NAD+ transporter 2, ARABIDOPSI...		Potri.008G123700 [exp]	15.62	0.6049
AT4G28990			RNA-binding protein-related (....		Potri.006G160500 [exp]	18.76	0.5781
AT5G41210		GSTU12, GST10, ...	glutathione S-transferase THET...		Potri.003G125800 [exp]	21.79	0.5433	ATGSTT1.2
AT4G14410	bHLH	bHLH104	basic Helix-Loop-Helix 104, ba...		Potri.008G165700 [exp]	27.65	0.5633
AT3G17380			TRAF-like family protein (.1)		Potri.014G055400 [exp]	28.46	0.5849
AT5G37780		ACAM-1, TCH1, C...	TOUCH 1, calmodulin 1 (.1.2.3)		Potri.015G032600 [exp]	37.30	0.5383	ACCAL.6
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Potri.001G167400 [exp]	43.81	0.5915

Compare expression of checked genes

Potri.010G226300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.