Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR65
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19830 51 / 3e-09 SAUR-like auxin-responsive protein family (.1) AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1) AT3G09870 50 / 7e-09 SAUR-like auxin-responsive protein family (.1) AT4G34760 41 / 2e-05 SAUR-like auxin-responsive protein family (.1) AT4G34780 40 / 4e-05 SAUR-like auxin-responsive protein family (.1) AT4G34790 39 / 0.0002 SAUR-like auxin-responsive protein family (.1) AT4G34770 38 / 0.0003 SAUR-like auxin-responsive protein family (.1) AT1G76190 37 / 0.0007 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G092400 [exp] 52 / 1e-09 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1) Potri.006G125100 [exp] 50 / 1e-08 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 40 / 5e-05 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 40 / 6e-05 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.003G113100 [exp] 39 / 0.0002 AT4G12410 149 / 1e-46 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 38 / 0.0002 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.001G119900 [exp] 37 / 0.0007 AT4G12410 140 / 8e-43 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016129 [exp] 68 / 2e-15 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1) Lus10016130 [exp] 67 / 4e-15 AT2G28085 111 / 2e-32 SAUR-like auxin-responsive protein family (.1) Lus10021436 [exp] 66 / 1e-14 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1) Lus10021435 [exp] 66 / 1e-14 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1) Lus10013819 [exp] 55 / 3e-10 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1) Lus10001397 [exp] 52 / 1e-09 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1) Lus10004014 [exp] 52 / 1e-09 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1) Lus10026531 [exp] 52 / 4e-09 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1) Lus10023012 [exp] 51 / 6e-09 AT3G09870 97 / 5e-27 SAUR-like auxin-responsive protein family (.1) Lus10026532 [exp] 50 / 1e-08 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.010G226400.1 pacid=42799152 polypeptide=Potri.010G226400.1.p locus=Potri.010G226400 ID=Potri.010G226400.1.v4.1 annot-version=v4.1 ATGGGCATACTTAGAGCTACTGGTAAGAAAAATATTGGCATTCTAAAGTTGAGGGTTGTGGCAGAGAAACTACAGAAGAGTCTTTCACTGGGCTGGAAAG AAGCCTCCAAGTACAGAAAAATTCATGAATATCATGGGAAATGCTCTCCATTGCCAAAGGATGTGAAGGTAGGGCACTTTGCTGTGATTGCAATCGAAAA TGGTGATCCTAAGCGATTTGTTGTGCCTTTGAGCTACTTAAACCATCCAAGGTTCTTGGTGCTGCTGGAGGAAGCAGCAGAAGAGTTTGGTTTTGGTCAT GAAGGTGCACTTAGCATTCCTTGCCAGTGGAGAGAAGTTGAAAAGTTATTAGCCAGCGACAATTAA
AA sequence Show only first row Show all	>Potri.010G226400.1 pacid=42799152 polypeptide=Potri.010G226400.1.p locus=Potri.010G226400 ID=Potri.010G226400.1.v4.1 annot-version=v4.1 MGILRATGKKNIGILKLRVVAEKLQKSLSLGWKEASKYRKIHEYHGKCSPLPKDVKVGHFAVIAIENGDPKRFVVPLSYLNHPRFLVLLEEAAEEFGFGH EGALSIPCQWREVEKLLASDN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G28085			SAUR-like auxin-responsive pro...		Potri.010G226400 [exp]	0	1	SAUR65
AT3G52770		ZPR3	LITTLE ZIPPER 3, protein bindi...		Potri.008G021766 [exp]	9.94	0.7440
					Potri.005G098650 [exp]	15.68	0.6505
					Potri.016G114100 [exp]	21.49	0.6738
AT3G55570			unknown protein		Potri.001G313801 [exp]	24.97	0.6472
AT4G31830			unknown protein		Potri.018G018300 [exp]	27.98	0.5822
					Potri.016G067501 [exp]	76.00	0.5879
AT5G61980		AGD1	ARF-GAP domain 1 (.1)		Potri.015G105500 [exp]	167.75	0.5331
AT2G25810		TIP4;1	tonoplast intrinsic protein 4;...		Potri.006G239700 [exp]	251.09	0.4859	TIP4.1

Compare expression of checked genes

Potri.010G226400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.