Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42250 214 / 2e-67 CYP712A1 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) AT1G50560 162 / 1e-47 CYP705A25 "cytochrome P450, family 705, subfamily A, polypeptide 25", cytochrome P450, family 705, subfamily A, polypeptide 25 (.1) AT5G06905 161 / 2e-47 CYP712A2 "cytochrome P450, family 712, subfamily A, polypeptide 2", cytochrome P450, family 712, subfamily A, polypeptide 2 (.1) AT3G20950 150 / 3e-43 CYP705A32 "cytochrome P450, family 705, subfamily A, polypeptide 32", cytochrome P450, family 705, subfamily A, polypeptide 32 (.1) AT5G47990 150 / 5e-43 THAD1, THAD, CYP705A5 THALIAN-DIOL DESATURASE, "cytochrome P450, family 705, subfamily A, polypeptide 5", cytochrome P450, family 705, subfamily A, polypeptide 5 (.1) AT3G20940 149 / 1e-42 CYP705A31P, CYP705A30 "cytochrome P450, family 705, subfamily A, polypeptide 30", cytochrome P450, family 705, subfamily A, polypeptide 30 (.1) AT3G20080 146 / 1e-42 CYP705A15 "cytochrome P450, family 705, subfamily A, polypeptide 15", cytochrome P450, family 705, subfamily A, polypeptide 15 (.1.2.3) AT3G20120 145 / 3e-42 CYP705A21 "cytochrome P450, family 705, subfamily A, polypeptide 21", cytochrome P450, family 705, subfamily A, polypeptide 21 (.1.2) AT1G50520 144 / 6e-41 CYP705A27 "cytochrome P450, family 705, subfamily A, polypeptide 27", cytochrome P450, family 705, subfamily A, polypeptide 27 (.1) AT3G20140 144 / 7e-41 CYP705A23 "cytochrome P450, family 705, subfamily A, polypeptide 23", cytochrome P450, family 705, subfamily A, polypeptide 23 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G057900 [exp] 269 / 1e-88 AT2G42250 725 / 0.0 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Potri.016G052600 [exp] 210 / 7e-66 AT2G42250 512 / 2e-178 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Potri.009G065100 [exp] 184 / 5e-57 AT1G50520 283 / 1e-90 "cytochrome P450, family 705, subfamily A, polypeptide 27", cytochrome P450, family 705, subfamily A, polypeptide 27 (.1) Potri.001G270900 [exp] 177 / 1e-53 AT5G47990 419 / 2e-142 THALIAN-DIOL DESATURASE, "cytochrome P450, family 705, subfamily A, polypeptide 5", cytochrome P450, family 705, subfamily A, polypeptide 5 (.1) Potri.006G190800 [exp] 176 / 6e-53 AT2G42250 509 / 2e-177 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Potri.009G066300 [exp] 175 / 2e-52 AT3G20140 419 / 2e-142 "cytochrome P450, family 705, subfamily A, polypeptide 23", cytochrome P450, family 705, subfamily A, polypeptide 23 (.1) Potri.009G065000 [exp] 174 / 3e-52 AT5G47990 425 / 1e-144 THALIAN-DIOL DESATURASE, "cytochrome P450, family 705, subfamily A, polypeptide 5", cytochrome P450, family 705, subfamily A, polypeptide 5 (.1) Potri.009G066200 [exp] 172 / 1e-51 AT4G15350 410 / 7e-139 "cytochrome P450, family 705, subfamily A, polypeptide 2", cytochrome P450, family 705, subfamily A, polypeptide 2 (.1) Potri.016G049800 [exp] 170 / 8e-51 AT5G06900 536 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023827 [exp] 233 / 1e-74 AT2G42250 652 / 0.0 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Lus10035502 [exp] 162 / 1e-47 AT5G06900 533 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10027798 [exp] 145 / 1e-42 AT5G06900 349 / 1e-117 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10040868 [exp] 133 / 1e-36 AT5G06900 434 / 5e-148 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10005878 [exp] 131 / 5e-36 AT5G06900 440 / 1e-150 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10013150 [exp] 121 / 2e-32 AT5G07990 403 / 4e-136 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Lus10021158 [exp] 120 / 8e-32 AT5G07990 706 / 0.0 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Lus10021620 [exp] 119 / 2e-31 AT5G07990 657 / 0.0 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Lus10008112 [exp] 118 / 4e-31 AT5G07990 407 / 2e-137 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Lus10008918 [exp] 113 / 1e-29 AT2G45550 483 / 1e-167 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.010G227301.1 pacid=42799455 polypeptide=Potri.010G227301.1.p locus=Potri.010G227301 ID=Potri.010G227301.1.v4.1 annot-version=v4.1 ATGAGCACAGGGTGTTCTGGTAGTGATAATGATGCCAAAAAGATTAAGAAGATGTGTGAGACTAGTACGAGGCTGGCTGGGAAGCTTGTTATAGGGGATA TCTTGGGTCCTTTCAAAAAAATTTATTCCTCTAGCAGTGGGAGGAAACTAGTTGGGGTACTAAAATATTATGATTGTTTGGTGGAAAGGATAATCAAGGA GCATGAAGAGAAGGCAAAGGAAGGTTTTGAAAGGGGGGATAGGAAGGATTTGACGGGCATATTGTTGGAGATATTTAAAGATCCAGCTGCTGAAATTAGG TTATCAAAAAATGACATCAAGTCTTTCTTGCTTGACATGTTCTTTGCTGTTACTGACACAACATCAGTGGCCTTGGAATGGGCAATGGCAGAGCTAATCA ACAACCCAGAGATATTCAAGAAGCTTAGAGATGAGATCAGTGCAGTTGTTGGGCCCAACAGGCTAGTCAAAGAATCTGACGTCCCAAATCTCCCTTACCT TAGGGCAATCATCAAGGAAACCTTAAGACTTCACCCTCCAGCACCGCACCCTTGA
AA sequence Show only first row Show all	>Potri.010G227301.1 pacid=42799455 polypeptide=Potri.010G227301.1.p locus=Potri.010G227301 ID=Potri.010G227301.1.v4.1 annot-version=v4.1 MSTGCSGSDNDAKKIKKMCETSTRLAGKLVIGDILGPFKKIYSSSSGRKLVGVLKYYDCLVERIIKEHEEKAKEGFERGDRKDLTGILLEIFKDPAAEIR LSKNDIKSFLLDMFFAVTDTTSVALEWAMAELINNPEIFKKLRDEISAVVGPNRLVKESDVPNLPYLRAIIKETLRLHPPAPHP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G42250		CYP712A1	"cytochrome P450, family 712, ...		Potri.010G227301 [exp]	0	1
AT4G14723		EPFL4, CLL2	epidermal patterning factor li...		Potri.008G157300 [exp]	19.79	0.7877
AT3G52130			Bifunctional inhibitor/lipid-t...		Potri.001G271000 [exp]	39.94	0.6582
AT2G27240			Aluminium activated malate tra...		Potri.001G217200 [exp]	48.98	0.7536
AT1G48600		AtPMEAMT	phosphoethanolamine N-methyltr...		Potri.015G039000 [exp]	49.08	0.7497
AT3G21700		ATSGP2	Ras-related small GTP-binding ...		Potri.014G152100 [exp]	53.85	0.7497
AT1G60060			Serine/threonine-protein kinas...		Potri.010G096400 [exp]	56.53	0.7391
AT2G18500	OFP	ATOFP7, OFP7	ARABIDOPSIS THALIANA OVATE FAM...		Potri.005G125200 [exp]	68.35	0.6405
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Potri.001G227400 [exp]	70.99	0.7387
AT2G23060			Acyl-CoA N-acyltransferases (N...		Potri.010G144700 [exp]	73.97	0.7385
AT3G13960	GRF	ATGRF5	growth-regulating factor 5 (.1...		Potri.001G169100 [exp]	74.57	0.7280

Compare expression of checked genes

Potri.010G227301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.