Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59910 191 / 3e-63 HTB4 Histone superfamily protein (.1) AT2G28720 188 / 4e-62 Histone superfamily protein (.1) AT1G07790 185 / 3e-61 HTB1 Histone superfamily protein (.1) AT5G02570 184 / 4e-61 Histone superfamily protein (.1) AT3G45980 185 / 5e-61 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1) AT3G46030 184 / 1e-60 HTB11 Histone superfamily protein (.1) AT5G22880 183 / 3e-60 HTB2, H2B HISTONE H2B, histone B2 (.1) AT3G53650 182 / 4e-60 Histone superfamily protein (.1) AT2G37470 181 / 2e-59 Histone superfamily protein (.1) AT3G09480 166 / 6e-54 Histone superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G030400 [exp] 195 / 5e-65 AT5G59910 191 / 2e-63 Histone superfamily protein (.1) Potri.008G030500 [exp] 193 / 2e-64 AT5G59910 190 / 4e-63 Histone superfamily protein (.1) Potri.010G230801 [exp] 190 / 3e-63 AT1G07790 205 / 2e-69 Histone superfamily protein (.1) Potri.010G230600 [exp] 190 / 3e-63 AT1G07790 205 / 3e-69 Histone superfamily protein (.1) Potri.010G231300 [exp] 189 / 5e-63 AT1G07790 177 / 3e-58 Histone superfamily protein (.1) Potri.009G028001 [exp] 189 / 2e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.017G123700 [exp] 188 / 2e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.008G030600 [exp] 188 / 2e-62 AT5G59910 188 / 2e-62 Histone superfamily protein (.1) Potri.004G091200 [exp] 187 / 5e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017456 [exp] 194 / 9e-65 AT2G28720 226 / 1e-77 Histone superfamily protein (.1) Lus10040855 [exp] 191 / 3e-63 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1) Lus10005897 [exp] 189 / 1e-62 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1) Lus10023753 [exp] 188 / 1e-62 AT2G37470 203 / 7e-69 Histone superfamily protein (.1) Lus10005893 [exp] 189 / 2e-62 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1) Lus10016156 [exp] 187 / 9e-62 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1) Lus10037371 [exp] 184 / 1e-60 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1) Lus10041347 [exp] 184 / 1e-60 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10013544 [exp] 183 / 3e-60 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10017292 [exp] 182 / 4e-60 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [poplar] [flax] Histone PF00125 [poplar] [flax] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Potri.010G230701.1 pacid=42797483 polypeptide=Potri.010G230701.1.p locus=Potri.010G230701 ID=Potri.010G230701.1.v4.1 annot-version=v4.1 ATGGCTCCTAAGGCAGCTGAGAAGAAGCCAGCAGCAGAGAAAGCCCCAGCGGAGAAGAAGCCAGCTGAGAAGAAGCCAGCAGCAGGGAAAGCCCCAGCGG AGAAGAAGCCAAGAGCCGAGAAGAAGTTGCCTAAAGAAGGAGGAGCGATTGACAAGAAGAAGAAGAGGGCAAAGAAGAGCGTTGAGACCTACAAGATCTA TATCTTCAAGGTTTTGAAACAAGTCCACCCTGATATTGGGATTTCAAGCAAGGCTATGGGTATCATGAACAGTTTCATCAATGATATCTTTGAGAAGCTT GCTCAAGAGGCTTCAAGGCTCGCTAGGTATAACAAGAAGCCCACCATTACTTCTCGGGAGATCCAGACTGCTGTCAGATTGGTTTTGCCTGGAGAGCTTG CGAAACATGCTGTTTCTGAAGGGACCAAGGCTGTCACCAAATTTACCAGCTCATAG
AA sequence Show only first row Show all	>Potri.010G230701.1 pacid=42797483 polypeptide=Potri.010G230701.1.p locus=Potri.010G230701 ID=Potri.010G230701.1.v4.1 annot-version=v4.1 MAPKAAEKKPAAEKAPAEKKPAEKKPAAGKAPAEKKPRAEKKLPKEGGAIDKKKKRAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL AQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59910		HTB4	Histone superfamily protein (....		Potri.010G230701 [exp]	0	1
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Potri.005G219100 [exp]	12.24	0.7137
AT3G12410			Polynucleotidyl transferase, r...		Potri.006G031400 [exp]	16.91	0.6797
AT1G29790			S-adenosyl-L-methionine-depend...		Potri.011G079000 [exp]	31.36	0.6976
AT4G10920		KELP	transcriptional coactivator p1...		Potri.001G089400 [exp]	31.52	0.7038
AT3G02820			zinc knuckle (CCHC-type) famil...		Potri.010G097400 [exp]	51.30	0.6409
AT4G29510		ATPRMT1B, ATPRM...	PROTEIN ARGININE METHYLTRANSFE...		Potri.006G149400 [exp]	61.41	0.6605
AT1G22920		CSN5A, JAB1, AJ...	ARABIDOPSIS JAB1 HOMOLOG 1, CO...		Potri.018G006100 [exp]	62.60	0.6345	AJH1.3
AT4G30240			Syntaxin/t-SNARE family protei...		Potri.015G078400 [exp]	88.74	0.6456
AT1G09810		ECT11	evolutionarily conserved C-ter...		Potri.003G008400 [exp]	102.47	0.6062
AT1G30880			unknown protein		Potri.003G155400 [exp]	106.73	0.6371

Compare expression of checked genes

Potri.010G230701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.